Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 82759..83285 | Replicon | plasmid unnamed5 |
Accession | NZ_CP104841 | ||
Organism | Enterobacter cloacae strain 2022CK-00409 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | N7S94_RS26435 | Protein ID | WP_000323025.1 |
Coordinates | 82759..83046 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | N7S94_RS26440 | Protein ID | WP_000534858.1 |
Coordinates | 83046..83285 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7S94_RS26400 (N7S94_26395) | 77900..78427 | - | 528 | WP_007372155.1 | hypothetical protein | - |
N7S94_RS26405 (N7S94_26400) | 78507..79391 | - | 885 | WP_007372154.1 | hypothetical protein | - |
N7S94_RS26410 (N7S94_26405) | 79591..79992 | - | 402 | WP_020996135.1 | hypothetical protein | - |
N7S94_RS26415 (N7S94_26410) | 80083..80544 | - | 462 | WP_009653863.1 | hypothetical protein | - |
N7S94_RS26420 (N7S94_26415) | 80928..81263 | - | 336 | WP_008786801.1 | PerC family transcriptional regulator | - |
N7S94_RS26425 (N7S94_26420) | 81272..81589 | - | 318 | WP_020996134.1 | hypothetical protein | - |
N7S94_RS26430 (N7S94_26425) | 81699..82706 | - | 1008 | WP_261659470.1 | phosphoadenosine phosphosulfate reductase family protein | - |
N7S94_RS26435 (N7S94_26430) | 82759..83046 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
N7S94_RS26440 (N7S94_26435) | 83046..83285 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
N7S94_RS26445 (N7S94_26440) | 83310..83414 | + | 105 | Protein_98 | hypothetical protein | - |
N7S94_RS26450 (N7S94_26445) | 83548..84471 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
N7S94_RS26455 (N7S94_26450) | 84671..85243 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
N7S94_RS26460 (N7S94_26455) | 85886..87226 | - | 1341 | WP_000589001.1 | ISNCY family transposase | - |
N7S94_RS26465 (N7S94_26460) | 87378..87701 | - | 324 | WP_020996132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..318750 | 318750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T259225 WP_000323025.1 NZ_CP104841:c83046-82759 [Enterobacter cloacae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|