Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 167828..168567 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP104838 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A5E1AVR5 |
| Locus tag | N7S94_RS25560 | Protein ID | WP_013087172.1 |
| Coordinates | 168082..168567 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A5E1AWX8 |
| Locus tag | N7S94_RS25555 | Protein ID | WP_012540086.1 |
| Coordinates | 167828..168094 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS25525 (N7S94_25520) | 163058..163594 | - | 537 | WP_178328939.1 | GNAT family N-acetyltransferase | - |
| N7S94_RS25530 (N7S94_25525) | 163719..165470 | - | 1752 | WP_178328940.1 | arsenical pump-driving ATPase | - |
| N7S94_RS25535 (N7S94_25530) | 165497..165859 | - | 363 | WP_013087168.1 | arsenic metallochaperone ArsD family protein | - |
| N7S94_RS25540 (N7S94_25535) | 165935..166480 | - | 546 | WP_047365773.1 | sigma-70 family RNA polymerase sigma factor | - |
| N7S94_RS25545 (N7S94_25540) | 166489..167202 | - | 714 | WP_178328938.1 | arsenical resistance protein ArsH | - |
| N7S94_RS25550 (N7S94_25545) | 167204..167527 | - | 324 | WP_013087171.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| N7S94_RS25555 (N7S94_25550) | 167828..168094 | + | 267 | WP_012540086.1 | DUF1778 domain-containing protein | Antitoxin |
| N7S94_RS25560 (N7S94_25555) | 168082..168567 | + | 486 | WP_013087172.1 | GNAT family N-acetyltransferase | Toxin |
| N7S94_RS25565 (N7S94_25560) | 168942..169639 | + | 698 | WP_261659429.1 | IS1 family transposase | - |
| N7S94_RS25570 (N7S94_25565) | 169853..170836 | + | 984 | WP_213382218.1 | tyrosine-type recombinase/integrase | - |
| N7S94_RS25575 (N7S94_25570) | 171204..172823 | + | 1620 | WP_023332837.1 | phosphoethanolamine--lipid A transferase MCR-10.1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mcr-10 | - | 1..189847 | 189847 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17810.62 Da Isoelectric Point: 9.8560
>T259224 WP_013087172.1 NZ_CP104838:168082-168567 [Enterobacter cloacae]
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1AVR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1AWX8 |