Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 135074..135717 Replicon plasmid unnamed2
Accession NZ_CP104838
Organism Enterobacter cloacae strain 2022CK-00409

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag N7S94_RS25360 Protein ID WP_213382977.1
Coordinates 135301..135717 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A330D345
Locus tag N7S94_RS25355 Protein ID WP_024553479.1
Coordinates 135074..135304 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7S94_RS25325 (N7S94_25320) 130533..130961 + 429 Protein_151 IS3 family transposase -
N7S94_RS25330 (N7S94_25325) 131634..133142 + 1509 WP_001189111.1 group II intron reverse transcriptase/maturase -
N7S94_RS25335 (N7S94_25330) 133223..133699 + 477 Protein_153 IS3 family transposase -
N7S94_RS25340 (N7S94_25335) 133720..133881 + 162 Protein_154 IS110 family transposase -
N7S94_RS25345 (N7S94_25340) 133899..134051 + 153 Protein_155 VapC toxin family PIN domain ribonuclease -
N7S94_RS25350 (N7S94_25345) 134241..134567 + 327 WP_071789783.1 four-helix bundle copper-binding protein -
N7S94_RS25355 (N7S94_25350) 135074..135304 + 231 WP_024553479.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N7S94_RS25360 (N7S94_25355) 135301..135717 + 417 WP_213382977.1 type II toxin-antitoxin system VapC family toxin Toxin
N7S94_RS25365 (N7S94_25360) 135841..136809 + 969 WP_074181092.1 IS5 family transposase -
N7S94_RS25370 (N7S94_25365) 137161..138141 + 981 WP_211944345.1 IS5-like element ISKpn26 family transposase -
N7S94_RS25375 (N7S94_25370) 138412..139638 + 1227 WP_197385529.1 OprD family outer membrane porin -
N7S94_RS25380 (N7S94_25375) 139744..140280 + 537 WP_213382405.1 GntR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-10 - 1..189847 189847
- inside IScluster/Tn - - 129059..147111 18052


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15093.55 Da        Isoelectric Point: 7.7814

>T259223 WP_213382977.1 NZ_CP104838:135301-135717 [Enterobacter cloacae]
VNKIYMLDTCICSFIMREQPEAVLKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTEIKVALRLTGTPIGPNDTAIAGHAIAAGAVLVTNNTREFARVPGLILEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8663.74 Da        Isoelectric Point: 4.3654

>AT259223 WP_024553479.1 NZ_CP104838:135074-135304 [Enterobacter cloacae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADADFMAEREDVVTDEGRVDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A330D345

References