Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 135074..135717 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP104838 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | N7S94_RS25360 | Protein ID | WP_213382977.1 |
| Coordinates | 135301..135717 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A330D345 |
| Locus tag | N7S94_RS25355 | Protein ID | WP_024553479.1 |
| Coordinates | 135074..135304 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS25325 (N7S94_25320) | 130533..130961 | + | 429 | Protein_151 | IS3 family transposase | - |
| N7S94_RS25330 (N7S94_25325) | 131634..133142 | + | 1509 | WP_001189111.1 | group II intron reverse transcriptase/maturase | - |
| N7S94_RS25335 (N7S94_25330) | 133223..133699 | + | 477 | Protein_153 | IS3 family transposase | - |
| N7S94_RS25340 (N7S94_25335) | 133720..133881 | + | 162 | Protein_154 | IS110 family transposase | - |
| N7S94_RS25345 (N7S94_25340) | 133899..134051 | + | 153 | Protein_155 | VapC toxin family PIN domain ribonuclease | - |
| N7S94_RS25350 (N7S94_25345) | 134241..134567 | + | 327 | WP_071789783.1 | four-helix bundle copper-binding protein | - |
| N7S94_RS25355 (N7S94_25350) | 135074..135304 | + | 231 | WP_024553479.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N7S94_RS25360 (N7S94_25355) | 135301..135717 | + | 417 | WP_213382977.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N7S94_RS25365 (N7S94_25360) | 135841..136809 | + | 969 | WP_074181092.1 | IS5 family transposase | - |
| N7S94_RS25370 (N7S94_25365) | 137161..138141 | + | 981 | WP_211944345.1 | IS5-like element ISKpn26 family transposase | - |
| N7S94_RS25375 (N7S94_25370) | 138412..139638 | + | 1227 | WP_197385529.1 | OprD family outer membrane porin | - |
| N7S94_RS25380 (N7S94_25375) | 139744..140280 | + | 537 | WP_213382405.1 | GntR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mcr-10 | - | 1..189847 | 189847 | |
| - | inside | IScluster/Tn | - | - | 129059..147111 | 18052 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15093.55 Da Isoelectric Point: 7.7814
>T259223 WP_213382977.1 NZ_CP104838:135301-135717 [Enterobacter cloacae]
VNKIYMLDTCICSFIMREQPEAVLKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTEIKVALRLTGTPIGPNDTAIAGHAIAAGAVLVTNNTREFARVPGLILEDWVN
VNKIYMLDTCICSFIMREQPEAVLKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTEIKVALRLTGTPIGPNDTAIAGHAIAAGAVLVTNNTREFARVPGLILEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|