Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4149251..4149871 | Replicon | chromosome |
| Accession | NZ_CP104836 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A5E1A1U8 |
| Locus tag | N7S94_RS20250 | Protein ID | WP_013095889.1 |
| Coordinates | 4149251..4149469 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | N7S94_RS20255 | Protein ID | WP_008499288.1 |
| Coordinates | 4149497..4149871 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS20220 (N7S94_20215) | 4144402..4144467 | + | 66 | Protein_3945 | 50S ribosomal protein L36 | - |
| N7S94_RS20225 (N7S94_20220) | 4144464..4145174 | - | 711 | WP_023620096.1 | GNAT family protein | - |
| N7S94_RS20230 (N7S94_20225) | 4145276..4146736 | + | 1461 | WP_150057013.1 | PLP-dependent aminotransferase family protein | - |
| N7S94_RS20235 (N7S94_20230) | 4146708..4147175 | - | 468 | WP_013095887.1 | YlaC family protein | - |
| N7S94_RS20240 (N7S94_20235) | 4147290..4147841 | - | 552 | WP_013095888.1 | maltose O-acetyltransferase | - |
| N7S94_RS20245 (N7S94_20240) | 4148160..4149140 | - | 981 | WP_211944394.1 | IS5-like element ISKpn26 family transposase | - |
| N7S94_RS20250 (N7S94_20245) | 4149251..4149469 | - | 219 | WP_013095889.1 | HHA domain-containing protein | Toxin |
| N7S94_RS20255 (N7S94_20250) | 4149497..4149871 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| N7S94_RS20260 (N7S94_20255) | 4150411..4151406 | - | 996 | WP_261658817.1 | IS5 family transposase | - |
| N7S94_RS20265 (N7S94_20260) | 4151517..4151735 | - | 219 | WP_013095889.1 | HHA domain-containing protein | - |
| N7S94_RS20270 (N7S94_20265) | 4151763..4152137 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | - |
| N7S94_RS20275 (N7S94_20270) | 4152677..4153672 | - | 996 | WP_261658818.1 | IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4132782..4152137 | 19355 | |
| - | inside | IScluster/Tn | - | - | 4143189..4153672 | 10483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8625.98 Da Isoelectric Point: 8.9008
>T259221 WP_013095889.1 NZ_CP104836:c4149469-4149251 [Enterobacter cloacae]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT259221 WP_008499288.1 NZ_CP104836:c4149871-4149497 [Enterobacter cloacae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1A1U8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |