Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 2941575..2942191 | Replicon | chromosome |
Accession | NZ_CP104836 | ||
Organism | Enterobacter cloacae strain 2022CK-00409 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N7S94_RS14460 | Protein ID | WP_080292722.1 |
Coordinates | 2941575..2941946 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N7S94_RS14465 | Protein ID | WP_213382961.1 |
Coordinates | 2941949..2942191 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7S94_RS14445 (N7S94_14440) | 2939075..2939977 | + | 903 | WP_014833793.1 | formate dehydrogenase subunit beta | - |
N7S94_RS14450 (N7S94_14445) | 2939974..2940609 | + | 636 | WP_013099357.1 | formate dehydrogenase cytochrome b556 subunit | - |
N7S94_RS14455 (N7S94_14450) | 2940606..2941535 | + | 930 | WP_029882351.1 | formate dehydrogenase accessory protein FdhE | - |
N7S94_RS14460 (N7S94_14455) | 2941575..2941946 | - | 372 | WP_080292722.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N7S94_RS14465 (N7S94_14460) | 2941949..2942191 | - | 243 | WP_213382961.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
N7S94_RS14470 (N7S94_14465) | 2942740..2944227 | + | 1488 | WP_024191381.1 | group II intron reverse transcriptase/maturase | - |
N7S94_RS14475 (N7S94_14470) | 2944300..2945109 | + | 810 | WP_261658696.1 | alpha/beta hydrolase | - |
N7S94_RS14480 (N7S94_14475) | 2945158..2945565 | + | 408 | WP_048242260.1 | transposase | - |
N7S94_RS14485 (N7S94_14480) | 2945562..2945912 | + | 351 | WP_021567584.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13625.69 Da Isoelectric Point: 6.6407
>T259220 WP_080292722.1 NZ_CP104836:c2941946-2941575 [Enterobacter cloacae]
VNNMAVFDTNILIDLFNNRVEAADAIDHAASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFSGIDEVVTPYQL
VNNMAVFDTNILIDLFNNRVEAADAIDHAASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFSGIDEVVTPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|