Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2712850..2713454 | Replicon | chromosome |
| Accession | NZ_CP104836 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A421IJD5 |
| Locus tag | N7S94_RS13350 | Protein ID | WP_071843252.1 |
| Coordinates | 2713269..2713454 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A7Z1F6W0 |
| Locus tag | N7S94_RS13345 | Protein ID | WP_013094943.1 |
| Coordinates | 2712850..2713254 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS13330 (N7S94_13325) | 2708387..2709205 | - | 819 | WP_161657006.1 | helix-turn-helix domain-containing protein | - |
| N7S94_RS13335 (N7S94_13330) | 2709430..2710830 | + | 1401 | WP_020686524.1 | MFS transporter | - |
| N7S94_RS13340 (N7S94_13335) | 2710841..2712796 | + | 1956 | WP_261658677.1 | glycoside hydrolase family 127 protein | - |
| N7S94_RS13345 (N7S94_13340) | 2712850..2713254 | - | 405 | WP_013094943.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N7S94_RS13350 (N7S94_13345) | 2713269..2713454 | - | 186 | WP_071843252.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N7S94_RS13355 (N7S94_13350) | 2713665..2714258 | - | 594 | Protein_2614 | MipA/OmpV family protein | - |
| N7S94_RS13360 (N7S94_13355) | 2714405..2715385 | - | 981 | WP_211944394.1 | IS5-like element ISKpn26 family transposase | - |
| N7S94_RS13365 (N7S94_13360) | 2715456..2715794 | + | 339 | Protein_2616 | LysR substrate-binding domain-containing protein | - |
| N7S94_RS13370 (N7S94_13365) | 2715791..2717329 | - | 1539 | WP_020686520.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2714405..2715385 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6859.08 Da Isoelectric Point: 11.7891
>T259219 WP_071843252.1 NZ_CP104836:c2713454-2713269 [Enterobacter cloacae]
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14915.74 Da Isoelectric Point: 4.3036
>AT259219 WP_013094943.1 NZ_CP104836:c2713254-2712850 [Enterobacter cloacae]
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A421IJD5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z1F6W0 |