Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2327124..2327640 | Replicon | chromosome |
Accession | NZ_CP104836 | ||
Organism | Enterobacter cloacae strain 2022CK-00409 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N7S94_RS11510 | Protein ID | WP_178328142.1 |
Coordinates | 2327124..2327408 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V3EXX3 |
Locus tag | N7S94_RS11515 | Protein ID | WP_008501400.1 |
Coordinates | 2327398..2327640 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7S94_RS11495 (N7S94_11490) | 2322378..2324021 | + | 1644 | WP_261659351.1 | alpha,alpha-phosphotrehalase | - |
N7S94_RS11500 (N7S94_11495) | 2324395..2326533 | + | 2139 | WP_013095357.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N7S94_RS11505 (N7S94_11500) | 2326656..2327120 | + | 465 | WP_058683233.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N7S94_RS11510 (N7S94_11505) | 2327124..2327408 | - | 285 | WP_178328142.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7S94_RS11515 (N7S94_11510) | 2327398..2327640 | - | 243 | WP_008501400.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N7S94_RS11520 (N7S94_11515) | 2327718..2329628 | - | 1911 | WP_178328141.1 | PRD domain-containing protein | - |
N7S94_RS11525 (N7S94_11520) | 2329648..2330784 | - | 1137 | WP_261659352.1 | lactonase family protein | - |
N7S94_RS11530 (N7S94_11525) | 2330899..2331639 | - | 741 | WP_178328139.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10944.80 Da Isoelectric Point: 10.4610
>T259218 WP_178328142.1 NZ_CP104836:c2327408-2327124 [Enterobacter cloacae]
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVVAIGK
REKSAVYHDANKRL
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVVAIGK
REKSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|