Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2243307..2244061 | Replicon | chromosome |
| Accession | NZ_CP104836 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A6L5EGB6 |
| Locus tag | N7S94_RS11070 | Protein ID | WP_032669201.1 |
| Coordinates | 2243307..2243684 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N7S94_RS11075 | Protein ID | WP_074143921.1 |
| Coordinates | 2243735..2244061 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS11040 (N7S94_11035) | 2238915..2240762 | + | 1848 | WP_013098777.1 | RNA polymerase sigma factor RpoD | - |
| N7S94_RS11045 (N7S94_11040) | 2240864..2241370 | - | 507 | WP_261659342.1 | G/U mismatch-specific DNA glycosylase | - |
| N7S94_RS11055 (N7S94_11050) | 2241674..2242522 | - | 849 | WP_261659343.1 | DUF4942 domain-containing protein | - |
| N7S94_RS11060 (N7S94_11055) | 2242586..2242789 | - | 204 | WP_032669203.1 | DUF957 domain-containing protein | - |
| N7S94_RS11065 (N7S94_11060) | 2242819..2243310 | - | 492 | WP_032672023.1 | DUF5983 family protein | - |
| N7S94_RS11070 (N7S94_11065) | 2243307..2243684 | - | 378 | WP_032669201.1 | TA system toxin CbtA family protein | Toxin |
| N7S94_RS11075 (N7S94_11070) | 2243735..2244061 | - | 327 | WP_074143921.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N7S94_RS11080 (N7S94_11075) | 2244118..2244339 | - | 222 | WP_023567997.1 | DUF987 domain-containing protein | - |
| N7S94_RS11085 (N7S94_11080) | 2244360..2244548 | - | 189 | Protein_2177 | Mov34/MPN/PAD-1 family protein | - |
| N7S94_RS11090 (N7S94_11085) | 2244611..2245315 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N7S94_RS11095 (N7S94_11090) | 2245472..2247061 | - | 1590 | WP_023327681.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2229035..2254980 | 25945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14157.93 Da Isoelectric Point: 6.2236
>T259217 WP_032669201.1 NZ_CP104836:c2243684-2243307 [Enterobacter cloacae]
MQTQPLSSTQEATPRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLSSIDILRARKATGLMTRNDYRTVTDITTGKYREVQP
MQTQPLSSTQEATPRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLSSIDILRARKATGLMTRNDYRTVTDITTGKYREVQP
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|