Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2045623..2046283 | Replicon | chromosome |
| Accession | NZ_CP104836 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A5E1AGQ2 |
| Locus tag | N7S94_RS10115 | Protein ID | WP_023620447.1 |
| Coordinates | 2045623..2046036 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | N7S94_RS10120 | Protein ID | WP_261659322.1 |
| Coordinates | 2046017..2046283 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS10095 (N7S94_10090) | 2041616..2043349 | - | 1734 | WP_178328238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N7S94_RS10100 (N7S94_10095) | 2043355..2044068 | - | 714 | WP_129327561.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N7S94_RS10105 (N7S94_10100) | 2044097..2044993 | - | 897 | WP_178328239.1 | site-specific tyrosine recombinase XerD | - |
| N7S94_RS10110 (N7S94_10105) | 2045095..2045616 | + | 522 | WP_013098613.1 | flavodoxin FldB | - |
| N7S94_RS10115 (N7S94_10110) | 2045623..2046036 | - | 414 | WP_023620447.1 | protein YgfX | Toxin |
| N7S94_RS10120 (N7S94_10115) | 2046017..2046283 | - | 267 | WP_261659322.1 | FAD assembly factor SdhE | Antitoxin |
| N7S94_RS10125 (N7S94_10120) | 2046578..2047558 | + | 981 | WP_178328241.1 | tRNA-modifying protein YgfZ | - |
| N7S94_RS10130 (N7S94_10125) | 2047668..2048327 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| N7S94_RS10135 (N7S94_10130) | 2048593..2049324 | + | 732 | WP_020687085.1 | MurR/RpiR family transcriptional regulator | - |
| N7S94_RS10140 (N7S94_10135) | 2049441..2050874 | + | 1434 | WP_178328242.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16220.21 Da Isoelectric Point: 10.9554
>T259216 WP_023620447.1 NZ_CP104836:c2046036-2045623 [Enterobacter cloacae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLSSGMMLRLRQVGGGKCQHLWLAADSMDIAEWRELRRMLLQQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLSSGMMLRLRQVGGGKCQHLWLAADSMDIAEWRELRRMLLQQQPTQE
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|