Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 5319749..5320313 | Replicon | chromosome |
Accession | NZ_CP104835 | ||
Organism | Achromobacter xylosoxidans strain 2021CK-01139 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D6IHV7 |
Locus tag | N4T34_RS24685 | Protein ID | WP_020926667.1 |
Coordinates | 5319749..5320030 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0D6IHW1 |
Locus tag | N4T34_RS24690 | Protein ID | WP_020926666.1 |
Coordinates | 5320017..5320313 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T34_RS24660 (N4T34_24685) | 5314780..5315283 | - | 504 | WP_006386642.1 | flavin reductase family protein | - |
N4T34_RS24665 (N4T34_24690) | 5315307..5316320 | - | 1014 | WP_049051052.1 | LLM class flavin-dependent oxidoreductase | - |
N4T34_RS24670 (N4T34_24695) | 5316442..5317275 | + | 834 | WP_054483102.1 | IclR family transcriptional regulator | - |
N4T34_RS24675 (N4T34_24700) | 5317511..5318566 | + | 1056 | WP_054483104.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
N4T34_RS24680 (N4T34_24705) | 5318563..5319699 | + | 1137 | WP_054483106.1 | tRNA guanosine(34) transglycosylase Tgt | - |
N4T34_RS24685 (N4T34_24710) | 5319749..5320030 | - | 282 | WP_020926667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4T34_RS24690 (N4T34_24715) | 5320017..5320313 | - | 297 | WP_020926666.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4T34_RS24695 (N4T34_24720) | 5320686..5321030 | + | 345 | WP_006386647.1 | preprotein translocase subunit YajC | - |
N4T34_RS24700 (N4T34_24725) | 5321146..5323026 | + | 1881 | WP_006386648.1 | protein translocase subunit SecD | - |
N4T34_RS24705 (N4T34_24730) | 5323078..5324013 | + | 936 | WP_006386649.1 | protein translocase subunit SecF | - |
N4T34_RS24710 (N4T34_24735) | 5324179..5324550 | + | 372 | WP_054483108.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N4T34_RS24715 (N4T34_24740) | 5324547..5324858 | + | 312 | WP_006386651.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10262.77 Da Isoelectric Point: 7.0080
>T259209 WP_020926667.1 NZ_CP104835:c5320030-5319749 [Achromobacter xylosoxidans]
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6IHV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6IHW1 |