Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 2701046..2701726 | Replicon | chromosome |
Accession | NZ_CP104835 | ||
Organism | Achromobacter xylosoxidans strain 2021CK-01139 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N4T34_RS12915 | Protein ID | WP_006386381.1 |
Coordinates | 2701046..2701231 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4T34_RS12920 | Protein ID | WP_006386380.1 |
Coordinates | 2701307..2701726 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T34_RS12905 (N4T34_12910) | 2697185..2698588 | + | 1404 | WP_054482410.1 | dihydrolipoyl dehydrogenase | - |
N4T34_RS12910 (N4T34_12915) | 2698760..2700799 | - | 2040 | WP_054482409.1 | PEP/pyruvate-binding domain-containing protein | - |
N4T34_RS12915 (N4T34_12920) | 2701046..2701231 | + | 186 | WP_006386381.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N4T34_RS12920 (N4T34_12925) | 2701307..2701726 | + | 420 | WP_006386380.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N4T34_RS12925 (N4T34_12930) | 2701817..2703235 | - | 1419 | WP_054482408.1 | argininosuccinate lyase | - |
N4T34_RS12930 (N4T34_12935) | 2703448..2704779 | + | 1332 | WP_054482498.1 | mechanosensitive ion channel | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7058.16 Da Isoelectric Point: 10.6654
>T259208 WP_006386381.1 NZ_CP104835:2701046-2701231 [Achromobacter xylosoxidans]
MKYSEFKKWLERQGAVFVAHRSGSSHFRVTLNGATTIFPYHGSKEMGKHLEHEIKKQLGLK
MKYSEFKKWLERQGAVFVAHRSGSSHFRVTLNGATTIFPYHGSKEMGKHLEHEIKKQLGLK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15506.81 Da Isoelectric Point: 4.9597
>AT259208 WP_006386380.1 NZ_CP104835:2701307-2701726 [Achromobacter xylosoxidans]
MLTYPFTLTLDSNRTWLVRFPDIPEALTVGDDEQEAAINAREALEAALEIYFDARRPIPLPSPVSAGQASVTLPALITSK
VFLSNEMIQQGVRKAELARRMGVHMPQVDRLLDVRHASRIEQVESALEQLGRRLEVSLA
MLTYPFTLTLDSNRTWLVRFPDIPEALTVGDDEQEAAINAREALEAALEIYFDARRPIPLPSPVSAGQASVTLPALITSK
VFLSNEMIQQGVRKAELARRMGVHMPQVDRLLDVRHASRIEQVESALEQLGRRLEVSLA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|