Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1178954..1179527 | Replicon | chromosome |
Accession | NZ_CP104835 | ||
Organism | Achromobacter xylosoxidans strain 2021CK-01139 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N4T34_RS05645 | Protein ID | WP_049054629.1 |
Coordinates | 1179150..1179527 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N4T34_RS05640 | Protein ID | WP_054471260.1 |
Coordinates | 1178954..1179163 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T34_RS05620 (N4T34_05625) | 1174360..1175148 | - | 789 | WP_049054627.1 | helix-turn-helix transcriptional regulator | - |
N4T34_RS05625 (N4T34_05630) | 1175247..1176173 | + | 927 | WP_020924995.1 | DMT family transporter | - |
N4T34_RS05630 (N4T34_05635) | 1176186..1177004 | - | 819 | WP_054480704.1 | AAC(3) family N-acetyltransferase | - |
N4T34_RS05635 (N4T34_05640) | 1177156..1178829 | + | 1674 | WP_054480706.1 | energy-dependent translational throttle protein EttA | - |
N4T34_RS05640 (N4T34_05645) | 1178954..1179163 | + | 210 | WP_054471260.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N4T34_RS05645 (N4T34_05650) | 1179150..1179527 | + | 378 | WP_049054629.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4T34_RS05650 (N4T34_05655) | 1179595..1180128 | + | 534 | WP_054480708.1 | isochorismatase family protein | - |
N4T34_RS05655 (N4T34_05660) | 1180319..1180543 | + | 225 | WP_006388976.1 | glycine zipper 2TM domain-containing protein | - |
N4T34_RS05660 (N4T34_05665) | 1180673..1180930 | - | 258 | WP_006388977.1 | cell division topological specificity factor MinE | - |
N4T34_RS05665 (N4T34_05670) | 1180934..1181749 | - | 816 | WP_006388978.1 | septum site-determining protein MinD | - |
N4T34_RS05670 (N4T34_05675) | 1181938..1182855 | - | 918 | WP_054439442.1 | septum site-determining protein MinC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13846.11 Da Isoelectric Point: 6.3721
>T259206 WP_049054629.1 NZ_CP104835:1179150-1179527 [Achromobacter xylosoxidans]
MILVDTSIWIDHLSDGEPCLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGAMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
MILVDTSIWIDHLSDGEPCLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGAMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|