Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 197354..197907 | Replicon | chromosome |
Accession | NZ_CP104835 | ||
Organism | Achromobacter xylosoxidans strain 2021CK-01139 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N4T34_RS01010 | Protein ID | WP_026384933.1 |
Coordinates | 197629..197907 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N4T34_RS01005 | Protein ID | WP_054482352.1 |
Coordinates | 197354..197560 (+) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T34_RS00990 (N4T34_00990) | 193993..194970 | - | 978 | WP_054482353.1 | tripartite tricarboxylate transporter substrate binding protein | - |
N4T34_RS00995 (N4T34_00995) | 195162..195812 | - | 651 | WP_049052563.1 | hypothetical protein | - |
N4T34_RS01000 (N4T34_01000) | 195811..197256 | + | 1446 | WP_047992431.1 | RNA polymerase factor sigma-54 | - |
N4T34_RS01005 (N4T34_01005) | 197354..197560 | + | 207 | WP_054482352.1 | hypothetical protein | Antitoxin |
N4T34_RS01010 (N4T34_01010) | 197629..197907 | + | 279 | WP_026384933.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4T34_RS01015 (N4T34_01015) | 198086..198385 | + | 300 | WP_006386990.1 | (2Fe-2S)-binding protein | - |
N4T34_RS01020 (N4T34_01020) | 198355..199275 | - | 921 | WP_054482351.1 | LysR substrate-binding domain-containing protein | - |
N4T34_RS01025 (N4T34_01025) | 199440..200303 | + | 864 | WP_236260965.1 | DMT family transporter | - |
N4T34_RS01030 (N4T34_01030) | 200728..201204 | + | 477 | WP_006386993.1 | bacterioferritin | - |
N4T34_RS01035 (N4T34_01035) | 201289..201988 | - | 700 | Protein_206 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10369.93 Da Isoelectric Point: 9.5759
>T259205 WP_026384933.1 NZ_CP104835:197629-197907 [Achromobacter xylosoxidans]
MLDVSWLQTAADDLAGIISYIAERSPQAARNLRQRIDNAVLSLARHPCRYRAGRVSGTRECVVHPNYVVVYRVTALAIEV
VNIVHARREYPP
MLDVSWLQTAADDLAGIISYIAERSPQAARNLRQRIDNAVLSLARHPCRYRAGRVSGTRECVVHPNYVVVYRVTALAIEV
VNIVHARREYPP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|