Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 179110..179753 Replicon plasmid p2
Accession NZ_CP104798
Organism Klebsiella pneumoniae strain GX34

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag N7T97_RS28725 Protein ID WP_014386165.1
Coordinates 179337..179753 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag N7T97_RS28720 Protein ID WP_032408893.1
Coordinates 179110..179340 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7T97_RS28695 (N7T97_28700) 174183..175166 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
N7T97_RS28700 (N7T97_28705) 175185..176333 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
N7T97_RS28705 (N7T97_28710) 176504..177661 - 1158 WP_032408895.1 acetylornithine deacetylase -
N7T97_RS28710 (N7T97_28715) 177677..178351 - 675 WP_014386166.1 DUF1028 domain-containing protein -
N7T97_RS28715 (N7T97_28720) 178356..178790 - 435 WP_000103648.1 RidA family protein -
N7T97_RS28720 (N7T97_28725) 179110..179340 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N7T97_RS28725 (N7T97_28730) 179337..179753 + 417 WP_014386165.1 PIN domain-containing protein Toxin
N7T97_RS28730 (N7T97_28735) 180076..181044 + 969 WP_074422984.1 IS5-like element IS903B family transposase -
N7T97_RS28735 (N7T97_28740) 181224..181598 - 375 WP_032408891.1 hypothetical protein -
N7T97_RS28740 (N7T97_28745) 181654..181980 - 327 WP_004152639.1 hypothetical protein -
N7T97_RS28745 (N7T97_28750) 181977..182705 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
N7T97_RS28750 (N7T97_28755) 182702..183133 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-15 / mph(A) / blaOXA-1 / aac(6')-Ib-cr - 1..201292 201292
- flank IS/Tn - - 180076..181044 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T259204 WP_014386165.1 NZ_CP104798:179337-179753 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT259204 WP_032408893.1 NZ_CP104798:179110-179340 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References