Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 155214..155959 Replicon plasmid p2
Accession NZ_CP104798
Organism Klebsiella pneumoniae strain GX34

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag N7T97_RS28595 Protein ID WP_032408901.1
Coordinates 155468..155959 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag N7T97_RS28590 Protein ID WP_014386183.1
Coordinates 155214..155480 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7T97_RS28540 (N7T97_28545) 150766..151179 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
N7T97_RS28545 (N7T97_28550) 151180..151458 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
N7T97_RS28550 (N7T97_28555) 151448..151768 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
N7T97_RS28555 (N7T97_28560) 151849..152073 - 225 WP_014386189.1 hypothetical protein -
N7T97_RS28560 (N7T97_28565) 152084..152296 - 213 WP_014386188.1 hypothetical protein -
N7T97_RS28565 (N7T97_28570) 152358..152684 - 327 WP_014386187.1 hypothetical protein -
N7T97_RS28570 (N7T97_28575) 153321..153671 - 351 WP_014386186.1 hypothetical protein -
N7T97_RS28575 (N7T97_28580) 153668..153940 - 273 WP_032408902.1 hypothetical protein -
N7T97_RS28580 (N7T97_28585) 154130..154615 + 486 WP_014386185.1 hypothetical protein -
N7T97_RS28585 (N7T97_28590) 154859..155017 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
N7T97_RS28590 (N7T97_28595) 155214..155480 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
N7T97_RS28595 (N7T97_28600) 155468..155959 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
N7T97_RS28600 (N7T97_28605) 156400..156651 - 252 WP_032408900.1 aldo/keto reductase -
N7T97_RS28605 (N7T97_28610) 156848..158440 - 1593 Protein_172 IS66 family transposase -
N7T97_RS28610 (N7T97_28615) 158471..158821 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
N7T97_RS28615 (N7T97_28620) 158818..159258 - 441 WP_014386179.1 transposase -
N7T97_RS28620 (N7T97_28625) 159520..160275 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-15 / mph(A) / blaOXA-1 / aac(6')-Ib-cr - 1..201292 201292


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T259203 WP_032408901.1 NZ_CP104798:155468-155959 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT259203 WP_014386183.1 NZ_CP104798:155214-155480 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References