Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53667..54403 Replicon plasmid p2
Accession NZ_CP104798
Organism Klebsiella pneumoniae strain GX34

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag N7T97_RS28025 Protein ID WP_003026803.1
Coordinates 53921..54403 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag N7T97_RS28020 Protein ID WP_003026799.1
Coordinates 53667..53933 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7T97_RS27975 (N7T97_27980) 49729..50091 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
N7T97_RS27980 (N7T97_27985) 50141..50491 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
N7T97_RS27985 (N7T97_27990) 50849..51118 + 270 WP_004152102.1 hypothetical protein -
N7T97_RS27990 (N7T97_27995) 51106..51681 + 576 WP_004152103.1 hypothetical protein -
N7T97_RS27995 (N7T97_28000) 51712..52206 + 495 WP_004152104.1 DNA-binding protein -
N7T97_RS28000 (N7T97_28005) 52250..52618 + 369 WP_004152105.1 hypothetical protein -
N7T97_RS28005 (N7T97_28010) 52652..52855 + 204 WP_004152106.1 HHA domain-containing protein -
N7T97_RS28010 (N7T97_28015) 52904..53161 + 258 WP_004152107.1 hypothetical protein -
N7T97_RS28015 (N7T97_28020) 53237..53491 + 255 WP_004152108.1 hypothetical protein -
N7T97_RS28020 (N7T97_28025) 53667..53933 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
N7T97_RS28025 (N7T97_28030) 53921..54403 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
N7T97_RS28030 (N7T97_28035) 54611..55957 + 1347 WP_077255522.1 ISNCY family transposase -
N7T97_RS28035 (N7T97_28040) 56006..56404 + 399 WP_032422684.1 helix-turn-helix domain-containing protein -
N7T97_RS28040 (N7T97_28045) 56600..57946 + 1347 WP_020314316.1 ISNCY family transposase -
N7T97_RS28045 (N7T97_28050) 58107..58238 + 132 WP_004218042.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-15 / mph(A) / blaOXA-1 / aac(6')-Ib-cr - 1..201292 201292


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T259202 WP_003026803.1 NZ_CP104798:53921-54403 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT259202 WP_003026799.1 NZ_CP104798:53667-53933 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References