Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5220730..5221355 | Replicon | chromosome |
| Accession | NZ_CP104796 | ||
| Organism | Klebsiella pneumoniae strain GX34 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N7T97_RS26320 | Protein ID | WP_040182550.1 |
| Coordinates | 5220730..5221113 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | N7T97_RS26325 | Protein ID | WP_004150355.1 |
| Coordinates | 5221113..5221355 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7T97_RS26305 (5218096) | 5218096..5218998 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| N7T97_RS26310 (5218995) | 5218995..5219630 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N7T97_RS26315 (5219627) | 5219627..5220556 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| N7T97_RS26320 (5220730) | 5220730..5221113 | - | 384 | WP_040182550.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N7T97_RS26325 (5221113) | 5221113..5221355 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| N7T97_RS26330 (5221560) | 5221560..5222477 | + | 918 | WP_023302328.1 | alpha/beta hydrolase | - |
| N7T97_RS26335 (5222491) | 5222491..5223432 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| N7T97_RS26340 (5223477) | 5223477..5223914 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| N7T97_RS26345 (5223911) | 5223911..5224771 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| N7T97_RS26350 (5224765) | 5224765..5225364 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14376.67 Da Isoelectric Point: 9.5352
>T259201 WP_040182550.1 NZ_CP104796:c5221113-5220730 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|