Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3995207..3995826 Replicon chromosome
Accession NZ_CP104796
Organism Klebsiella pneumoniae strain GX34

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N7T97_RS20340 Protein ID WP_002892050.1
Coordinates 3995608..3995826 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N7T97_RS20335 Protein ID WP_002892066.1
Coordinates 3995207..3995581 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7T97_RS20325 (3990359) 3990359..3991552 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N7T97_RS20330 (3991575) 3991575..3994721 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N7T97_RS20335 (3995207) 3995207..3995581 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N7T97_RS20340 (3995608) 3995608..3995826 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N7T97_RS20345 (3995989) 3995989..3996555 + 567 WP_002892030.1 maltose O-acetyltransferase -
N7T97_RS20350 (3996527) 3996527..3996667 - 141 WP_004147370.1 hypothetical protein -
N7T97_RS20355 (3996688) 3996688..3997158 + 471 WP_040182126.1 YlaC family protein -
N7T97_RS20360 (3997133) 3997133..3998584 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N7T97_RS20365 (3998685) 3998685..3999383 + 699 WP_002892021.1 GNAT family protein -
N7T97_RS20370 (3999380) 3999380..3999520 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N7T97_RS20375 (3999520) 3999520..3999783 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T259197 WP_002892050.1 NZ_CP104796:3995608-3995826 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT259197 WP_002892066.1 NZ_CP104796:3995207-3995581 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References