Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 3232134..3232699 | Replicon | chromosome |
Accession | NZ_CP104794 | ||
Organism | Streptomyces sp. FZ201 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | N6J21_RS14370 | Protein ID | WP_250744431.1 |
Coordinates | 3232134..3232502 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | N6J21_RS14375 | Protein ID | WP_093721371.1 |
Coordinates | 3232502..3232699 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6J21_RS14350 | 3227490..3228449 | + | 960 | WP_093721367.1 | glycine betaine ABC transporter substrate-binding protein | - |
N6J21_RS14355 | 3228465..3229256 | - | 792 | WP_093721368.1 | S16 family serine protease | - |
N6J21_RS14360 | 3229301..3229942 | - | 642 | WP_093721413.1 | helix-turn-helix domain-containing protein | - |
N6J21_RS14365 | 3230233..3232026 | - | 1794 | WP_093721369.1 | DEAD/DEAH box helicase | - |
N6J21_RS14370 | 3232134..3232502 | - | 369 | WP_250744431.1 | Fic family protein | Toxin |
N6J21_RS14375 | 3232502..3232699 | - | 198 | WP_093721371.1 | hypothetical protein | Antitoxin |
N6J21_RS14380 | 3232732..3234177 | - | 1446 | WP_261718512.1 | MFS transporter | - |
N6J21_RS14385 | 3234266..3234787 | - | 522 | WP_093721373.1 | SUKH-4 family immunity protein | - |
N6J21_RS14390 | 3234859..3237171 | - | 2313 | WP_093721374.1 | molybdopterin-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13748.58 Da Isoelectric Point: 4.8625
>T259188 WP_250744431.1 NZ_CP104794:c3232502-3232134 [Streptomyces sp. FZ201]
MHYLTLPELLHLAKRLGADEVRDYGLLDSALARPQSSVFGQDAYPDVWQKAAALMESLARNHSLVDGNKRIAWYATWVFL
HLNGHPLDAEFDVDEAEQFVLDVCQGDLDVTKIAAQLPRFAR
MHYLTLPELLHLAKRLGADEVRDYGLLDSALARPQSSVFGQDAYPDVWQKAAALMESLARNHSLVDGNKRIAWYATWVFL
HLNGHPLDAEFDVDEAEQFVLDVCQGDLDVTKIAAQLPRFAR
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|