Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 42775..43376 | Replicon | plasmid pHNSHP24-3 |
Accession | NZ_CP104791 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | N6H17_RS26390 | Protein ID | WP_001216034.1 |
Coordinates | 42775..43155 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | N6H17_RS26395 | Protein ID | WP_001190712.1 |
Coordinates | 43155..43376 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS26360 (N6H17_26370) | 37875..37994 | - | 120 | WP_071594056.1 | ash family protein | - |
N6H17_RS26365 (N6H17_26375) | 38216..39700 | - | 1485 | WP_096321054.1 | terminase | - |
N6H17_RS26370 (N6H17_26380) | 39700..40893 | - | 1194 | WP_096321055.1 | terminase | - |
N6H17_RS26375 (N6H17_26385) | 40979..41431 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
N6H17_RS26380 (N6H17_26390) | 41520..42563 | - | 1044 | WP_009446825.1 | DUF968 domain-containing protein | - |
N6H17_RS26385 (N6H17_26395) | 42591..42770 | - | 180 | WP_001339207.1 | hypothetical protein | - |
N6H17_RS26390 (N6H17_26400) | 42775..43155 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
N6H17_RS26395 (N6H17_26405) | 43155..43376 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N6H17_RS26400 (N6H17_26410) | 43559..45115 | + | 1557 | WP_112917413.1 | type I restriction-modification system subunit M | - |
N6H17_RS26405 (N6H17_26415) | 45112..46317 | + | 1206 | WP_001293319.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mcr-1.1 | - | 1..99354 | 99354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T259187 WP_001216034.1 NZ_CP104791:c43155-42775 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |