Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 176137..176762 | Replicon | plasmid pHNSHP24-2 |
Accession | NZ_CP104790 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N6H17_RS26110 | Protein ID | WP_000911313.1 |
Coordinates | 176137..176535 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2X7GCP6 |
Locus tag | N6H17_RS26115 | Protein ID | WP_000450528.1 |
Coordinates | 176535..176762 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS26090 (172310) | 172310..172915 | + | 606 | WP_261629686.1 | conjugal transfer pilus-stabilizing protein TraP | - |
N6H17_RS26100 (173604) | 173604..173888 | + | 285 | Protein_185 | hypothetical protein | - |
N6H17_RS26105 (173939) | 173939..176128 | + | 2190 | WP_261629687.1 | type IV conjugative transfer system coupling protein TraD | - |
N6H17_RS26110 (176137) | 176137..176535 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N6H17_RS26115 (176535) | 176535..176762 | - | 228 | WP_000450528.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | pic | 1..186621 | 186621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T259184 WP_000911313.1 NZ_CP104790:c176535-176137 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|