Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 1777..2534 | Replicon | plasmid pHNSHP24-2 |
Accession | NZ_CP104790 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A0L6ZF90 |
Locus tag | N6H17_RS25185 | Protein ID | WP_000501972.1 |
Coordinates | 2049..2534 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | N6H17_RS25180 | Protein ID | WP_072141942.1 |
Coordinates | 1777..2061 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS25175 (1) | 1..858 | + | 858 | WP_195686735.1 | incFII family plasmid replication initiator RepA | - |
N6H17_RS25180 (1777) | 1777..2061 | + | 285 | WP_072141942.1 | DUF1778 domain-containing protein | Antitoxin |
N6H17_RS25185 (2049) | 2049..2534 | + | 486 | WP_000501972.1 | GNAT family N-acetyltransferase | Toxin |
N6H17_RS25190 (3154) | 3154..4256 | - | 1103 | Protein_3 | transposase | - |
N6H17_RS25195 (4256) | 4256..4621 | - | 366 | WP_032233136.1 | hypothetical protein | - |
N6H17_RS25200 (4893) | 4893..5408 | - | 516 | WP_000419088.1 | YopT-type cysteine protease domain-containing protein | - |
N6H17_RS25205 (5570) | 5570..6607 | + | 1038 | Protein_6 | IS21 family transposase | - |
N6H17_RS25210 (6607) | 6607..7404 | + | 798 | WP_053295843.1 | IS21-like element IS21 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | pic | 1..186621 | 186621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17630.39 Da Isoelectric Point: 9.9107
>T259178 WP_000501972.1 NZ_CP104790:2049-2534 [Escherichia coli]
MGCVTAPEPLSSFHQVAEFVSGEAVLDDWLKQKGLKNQALGATRTFVVCRKGTQQVVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDASFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGFTPSKTQLQTLFLKLP
Q
MGCVTAPEPLSSFHQVAEFVSGEAVLDDWLKQKGLKNQALGATRTFVVCRKGTQQVVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDASFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGFTPSKTQLQTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|