Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4751155..4751987 | Replicon | chromosome |
| Accession | NZ_CP104788 | ||
| Organism | Escherichia coli strain SHP24 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | N6H17_RS23260 | Protein ID | WP_000854753.1 |
| Coordinates | 4751613..4751987 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | N6H17_RS23255 | Protein ID | WP_001315620.1 |
| Coordinates | 4751155..4751523 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6H17_RS23235 (4746650) | 4746650..4747327 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| N6H17_RS23240 (4747327) | 4747327..4747674 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| N6H17_RS23245 (4747694) | 4747694..4749265 | + | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
| N6H17_RS23255 (4751155) | 4751155..4751523 | + | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N6H17_RS23260 (4751613) | 4751613..4751987 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| N6H17_RS23265 (4751984) | 4751984..4752472 | + | 489 | WP_000777547.1 | DUF5983 family protein | - |
| N6H17_RS23270 (4752484) | 4752484..4752681 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| N6H17_RS23275 (4752766) | 4752766..4752915 | + | 150 | Protein_4531 | restriction endonuclease subunit M | - |
| N6H17_RS23280 (4753683) | 4753683..4753826 | - | 144 | Protein_4532 | HNH endonuclease | - |
| N6H17_RS23285 (4753963) | 4753963..4754613 | + | 651 | WP_261629548.1 | HNH endonuclease | - |
| N6H17_RS23290 (4754621) | 4754621..4755601 | - | 981 | WP_001295601.1 | sialate O-acetylesterase | - |
| N6H17_RS23295 (4755666) | 4755666..4756772 | - | 1107 | WP_001315214.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | fimB / fimE | 4717100..4761413 | 44313 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T259175 WP_000854753.1 NZ_CP104788:4751613-4751987 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13474.20 Da Isoelectric Point: 6.2050
>AT259175 WP_001315620.1 NZ_CP104788:4751155-4751523 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |