Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3355381..3356213 | Replicon | chromosome |
Accession | NZ_CP104788 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | N6H17_RS16525 | Protein ID | WP_000854816.1 |
Coordinates | 3355839..3356213 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | N6H17_RS16520 | Protein ID | WP_001285402.1 |
Coordinates | 3355381..3355749 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS16490 (3352018) | 3352018..3352473 | + | 456 | WP_000581504.1 | IrmA family protein | - |
N6H17_RS16495 (3352552) | 3352552..3352707 | + | 156 | WP_042960768.1 | DUF905 family protein | - |
N6H17_RS16500 (3352876) | 3352876..3353694 | + | 819 | WP_001234639.1 | DUF932 domain-containing protein | - |
N6H17_RS16505 (3353957) | 3353957..3354436 | + | 480 | WP_000706981.1 | antirestriction protein | - |
N6H17_RS16510 (3354452) | 3354452..3354928 | + | 477 | WP_001487922.1 | RadC family protein | - |
N6H17_RS16515 (3354997) | 3354997..3355218 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
N6H17_RS16520 (3355381) | 3355381..3355749 | + | 369 | WP_001285402.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N6H17_RS16525 (3355839) | 3355839..3356213 | + | 375 | WP_000854816.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
N6H17_RS16530 (3356210) | 3356210..3356701 | + | 492 | WP_000976865.1 | DUF5983 family protein | - |
N6H17_RS16535 (3356721) | 3356721..3356918 | + | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
N6H17_RS16540 (3357003) | 3357003..3357845 | + | 843 | WP_001274564.1 | DUF4942 domain-containing protein | - |
N6H17_RS16545 (3358126) | 3358126..3358662 | - | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
N6H17_RS16550 (3358706) | 3358706..3360109 | - | 1404 | Protein_3232 | inorganic phosphate transporter PitB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14045.05 Da Isoelectric Point: 9.1493
>T259171 WP_000854816.1 NZ_CP104788:3355839-3356213 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLSRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPRF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAK
MKTLPVLPGQAASSRPSPVEIWQTLLSRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPRF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13883.62 Da Isoelectric Point: 6.3165
>AT259171 WP_001285402.1 NZ_CP104788:3355381-3355749 [Escherichia coli]
VSDTHHETNYPDDYNNRPWWGLPCTITPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELILTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTHHETNYPDDYNNRPWWGLPCTITPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELILTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|