Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3220439..3221093 | Replicon | chromosome |
| Accession | NZ_CP104788 | ||
| Organism | Escherichia coli strain SHP24 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | N6H17_RS15835 | Protein ID | WP_000244777.1 |
| Coordinates | 3220439..3220846 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N6H17_RS15840 | Protein ID | WP_000354046.1 |
| Coordinates | 3220827..3221093 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6H17_RS15815 (3216396) | 3216396..3218129 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N6H17_RS15820 (3218135) | 3218135..3218845 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N6H17_RS15825 (3218870) | 3218870..3219766 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N6H17_RS15830 (3219878) | 3219878..3220399 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N6H17_RS15835 (3220439) | 3220439..3220846 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| N6H17_RS15840 (3220827) | 3220827..3221093 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N6H17_RS15845 (3221336) | 3221336..3222316 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| N6H17_RS15850 (3222512) | 3222512..3223171 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N6H17_RS15855 (3223335) | 3223335..3223646 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| N6H17_RS15860 (3223691) | 3223691..3225124 | + | 1434 | WP_001573179.1 | 6-phospho-beta-glucosidase BglA | - |
| N6H17_RS15865 (3225181) | 3225181..3225924 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T259170 WP_000244777.1 NZ_CP104788:c3220846-3220439 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |