Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1776180..1776706 | Replicon | chromosome |
Accession | NZ_CP104788 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | N6H17_RS08880 | Protein ID | WP_000323025.1 |
Coordinates | 1776180..1776467 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | N6H17_RS08885 | Protein ID | WP_000534858.1 |
Coordinates | 1776467..1776706 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS08830 (1771204) | 1771204..1771419 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
N6H17_RS08835 (1771639) | 1771639..1771809 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
N6H17_RS08840 (1772173) | 1772173..1772388 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
N6H17_RS08845 (1772689) | 1772689..1772901 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
N6H17_RS08850 (1772956) | 1772956..1773045 | + | 90 | WP_120795389.1 | hypothetical protein | - |
N6H17_RS08855 (1773323) | 1773323..1774075 | - | 753 | WP_001047135.1 | antitermination protein | - |
N6H17_RS08860 (1774089) | 1774089..1775138 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
N6H17_RS08865 (1775140) | 1775140..1775418 | - | 279 | WP_012304870.1 | hypothetical protein | - |
N6H17_RS08870 (1775485) | 1775485..1775736 | - | 252 | WP_000980994.1 | protein Rem | - |
N6H17_RS08875 (1775953) | 1775953..1776108 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
N6H17_RS08880 (1776180) | 1776180..1776467 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
N6H17_RS08885 (1776467) | 1776467..1776706 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
N6H17_RS08890 (1776731) | 1776731..1777036 | + | 306 | WP_001326990.1 | protein YdfV | - |
N6H17_RS08895 (1777239) | 1777239..1777571 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
N6H17_RS08900 (1778008) | 1778008..1778157 | - | 150 | WP_011443592.1 | protein YdfW | - |
N6H17_RS08905 (1778278) | 1778278..1779300 | - | 1023 | Protein_1740 | ISNCY family transposase | - |
N6H17_RS08910 (1780090) | 1780090..1780377 | - | 288 | Protein_1741 | hypothetical protein | - |
N6H17_RS08915 (1780855) | 1780855..1781344 | - | 490 | Protein_1742 | class I SAM-dependent methyltransferase | - |
N6H17_RS08920 (1781341) | 1781341..1781592 | - | 252 | Protein_1743 | DUF977 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1755317..1788900 | 33583 | |
- | inside | Prophage | - | - | 1751201..1788900 | 37699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T259163 WP_000323025.1 NZ_CP104788:c1776467-1776180 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|