Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1638286..1638924 | Replicon | chromosome |
Accession | NZ_CP104788 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N6H17_RS08185 | Protein ID | WP_000813794.1 |
Coordinates | 1638286..1638462 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N6H17_RS08190 | Protein ID | WP_001270286.1 |
Coordinates | 1638508..1638924 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS08165 (1635018) | 1635018..1635080 | - | 63 | Protein_1592 | benzoate transporter | - |
N6H17_RS08170 (1635172) | 1635172..1635708 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N6H17_RS08175 (1635781) | 1635781..1637742 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N6H17_RS08180 (1637834) | 1637834..1638064 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N6H17_RS08185 (1638286) | 1638286..1638462 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N6H17_RS08190 (1638508) | 1638508..1638924 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N6H17_RS08195 (1639003) | 1639003..1640409 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N6H17_RS08200 (1640654) | 1640654..1641799 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N6H17_RS08205 (1641817) | 1641817..1642830 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
N6H17_RS08210 (1642831) | 1642831..1643772 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T259161 WP_000813794.1 NZ_CP104788:1638286-1638462 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT259161 WP_001270286.1 NZ_CP104788:1638508-1638924 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|