Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 1298562..1299040 Replicon chromosome
Accession NZ_CP104788
Organism Escherichia coli strain SHP24

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A7D8WGY6
Locus tag N6H17_RS06395 Protein ID WP_000936798.1
Coordinates 1298562..1298849 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID D8A5B4
Locus tag N6H17_RS06400 Protein ID WP_000100899.1
Coordinates 1298849..1299040 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6H17_RS06360 (1293912) 1293912..1294181 - 270 WP_000003742.1 excisionase -
N6H17_RS06365 (1294243) 1294243..1296714 - 2472 WP_261629619.1 exonuclease -
N6H17_RS06370 (1296808) 1296808..1296999 - 192 WP_001090200.1 DUF1482 family protein -
N6H17_RS06375 (1296996) 1296996..1297184 - 189 WP_000449192.1 cell division inhibition protein DicB -
N6H17_RS06380 (1297753) 1297753..1297971 - 219 WP_001171969.1 protein YdfC -
N6H17_RS06385 (1298001) 1298001..1298129 - 129 WP_000344935.1 protein YdfB -
N6H17_RS06390 (1298131) 1298131..1298286 - 156 WP_032240568.1 DUF1391 family protein -
N6H17_RS06395 (1298562) 1298562..1298849 - 288 WP_000936798.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N6H17_RS06400 (1298849) 1298849..1299040 - 192 WP_000100899.1 hypothetical protein Antitoxin
N6H17_RS06405 (1299068) 1299068..1299469 - 402 WP_001329851.1 helix-turn-helix domain-containing protein -
N6H17_RS06410 (1299579) 1299579..1299851 + 273 WP_000887447.1 YdaS family helix-turn-helix protein -
N6H17_RS06415 (1299835) 1299835..1300260 + 426 WP_032207470.1 toxin YdaT family protein -
N6H17_RS06420 (1300281) 1300281..1301246 + 966 WP_001422090.1 hypothetical protein -
N6H17_RS06425 (1301253) 1301253..1301999 + 747 WP_001409081.1 ATP-binding protein -
N6H17_RS06430 (1302021) 1302021..1302791 + 771 WP_196611302.1 DUF1627 domain-containing protein -
N6H17_RS06435 (1302807) 1302807..1303199 + 393 WP_054192692.1 DUF977 family protein -
N6H17_RS06440 (1303196) 1303196..1303492 + 297 WP_001266130.1 DUF4406 domain-containing protein -
N6H17_RS06445 (1303489) 1303489..1303950 + 462 WP_001209473.1 ead/Ea22-like family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1285657..1346797 61140
- inside Prophage - - 1285657..1347967 62310


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10899.83 Da        Isoelectric Point: 10.1360

>T259160 WP_000936798.1 NZ_CP104788:c1298849-1298562 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7035.80 Da        Isoelectric Point: 4.0270

>AT259160 WP_000100899.1 NZ_CP104788:c1299040-1298849 [Escherichia coli]
MSTALSPIVSEFETTEQENSYNEWLRAKVASSLADPRPSIPHDEVMAEMENLIAQIAVTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D8WGY6

Antitoxin

Source ID Structure
AlphaFold DB A0A161RC07

References