Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 1298562..1299040 | Replicon | chromosome |
| Accession | NZ_CP104788 | ||
| Organism | Escherichia coli strain SHP24 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A7D8WGY6 |
| Locus tag | N6H17_RS06395 | Protein ID | WP_000936798.1 |
| Coordinates | 1298562..1298849 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | D8A5B4 |
| Locus tag | N6H17_RS06400 | Protein ID | WP_000100899.1 |
| Coordinates | 1298849..1299040 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6H17_RS06360 (1293912) | 1293912..1294181 | - | 270 | WP_000003742.1 | excisionase | - |
| N6H17_RS06365 (1294243) | 1294243..1296714 | - | 2472 | WP_261629619.1 | exonuclease | - |
| N6H17_RS06370 (1296808) | 1296808..1296999 | - | 192 | WP_001090200.1 | DUF1482 family protein | - |
| N6H17_RS06375 (1296996) | 1296996..1297184 | - | 189 | WP_000449192.1 | cell division inhibition protein DicB | - |
| N6H17_RS06380 (1297753) | 1297753..1297971 | - | 219 | WP_001171969.1 | protein YdfC | - |
| N6H17_RS06385 (1298001) | 1298001..1298129 | - | 129 | WP_000344935.1 | protein YdfB | - |
| N6H17_RS06390 (1298131) | 1298131..1298286 | - | 156 | WP_032240568.1 | DUF1391 family protein | - |
| N6H17_RS06395 (1298562) | 1298562..1298849 | - | 288 | WP_000936798.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N6H17_RS06400 (1298849) | 1298849..1299040 | - | 192 | WP_000100899.1 | hypothetical protein | Antitoxin |
| N6H17_RS06405 (1299068) | 1299068..1299469 | - | 402 | WP_001329851.1 | helix-turn-helix domain-containing protein | - |
| N6H17_RS06410 (1299579) | 1299579..1299851 | + | 273 | WP_000887447.1 | YdaS family helix-turn-helix protein | - |
| N6H17_RS06415 (1299835) | 1299835..1300260 | + | 426 | WP_032207470.1 | toxin YdaT family protein | - |
| N6H17_RS06420 (1300281) | 1300281..1301246 | + | 966 | WP_001422090.1 | hypothetical protein | - |
| N6H17_RS06425 (1301253) | 1301253..1301999 | + | 747 | WP_001409081.1 | ATP-binding protein | - |
| N6H17_RS06430 (1302021) | 1302021..1302791 | + | 771 | WP_196611302.1 | DUF1627 domain-containing protein | - |
| N6H17_RS06435 (1302807) | 1302807..1303199 | + | 393 | WP_054192692.1 | DUF977 family protein | - |
| N6H17_RS06440 (1303196) | 1303196..1303492 | + | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
| N6H17_RS06445 (1303489) | 1303489..1303950 | + | 462 | WP_001209473.1 | ead/Ea22-like family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1285657..1346797 | 61140 | |
| - | inside | Prophage | - | - | 1285657..1347967 | 62310 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10899.83 Da Isoelectric Point: 10.1360
>T259160 WP_000936798.1 NZ_CP104788:c1298849-1298562 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D8WGY6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A161RC07 |