Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 530095..530713 | Replicon | chromosome |
Accession | NZ_CP104788 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N6H17_RS02555 | Protein ID | WP_001291435.1 |
Coordinates | 530095..530313 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N6H17_RS02560 | Protein ID | WP_000344800.1 |
Coordinates | 530339..530713 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS02520 (525384) | 525384..525956 | + | 573 | WP_000779838.1 | YbaY family lipoprotein | - |
N6H17_RS02525 (525987) | 525987..526298 | - | 312 | WP_000409911.1 | MGMT family protein | - |
N6H17_RS02535 (526677) | 526677..527030 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N6H17_RS02540 (527072) | 527072..528622 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N6H17_RS02545 (528786) | 528786..529256 | - | 471 | WP_000136192.1 | YlaC family protein | - |
N6H17_RS02550 (529372) | 529372..529923 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N6H17_RS02555 (530095) | 530095..530313 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N6H17_RS02560 (530339) | 530339..530713 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N6H17_RS02565 (531259) | 531259..534408 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N6H17_RS02570 (534431) | 534431..535624 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T259159 WP_001291435.1 NZ_CP104788:c530313-530095 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT259159 WP_000344800.1 NZ_CP104788:c530713-530339 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |