Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53674..54410 Replicon plasmid unnamed
Accession NZ_CP104767
Organism Klebsiella pneumoniae strain IMT44613

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag N7Q99_RS26450 Protein ID WP_003026803.1
Coordinates 53928..54410 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag N7Q99_RS26445 Protein ID WP_003026799.1
Coordinates 53674..53940 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7Q99_RS26400 (N7Q99_26400) 49736..50098 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
N7Q99_RS26405 (N7Q99_26405) 50148..50498 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
N7Q99_RS26410 (N7Q99_26410) 50856..51125 + 270 WP_004152102.1 hypothetical protein -
N7Q99_RS26415 (N7Q99_26415) 51113..51688 + 576 WP_004152103.1 hypothetical protein -
N7Q99_RS26420 (N7Q99_26420) 51719..52213 + 495 WP_004152104.1 DNA-binding protein -
N7Q99_RS26425 (N7Q99_26425) 52257..52625 + 369 WP_004152105.1 hypothetical protein -
N7Q99_RS26430 (N7Q99_26430) 52659..52862 + 204 WP_004152106.1 HHA domain-containing protein -
N7Q99_RS26435 (N7Q99_26435) 52911..53168 + 258 WP_004152107.1 hypothetical protein -
N7Q99_RS26440 (N7Q99_26440) 53244..53498 + 255 WP_004152108.1 hypothetical protein -
N7Q99_RS26445 (N7Q99_26445) 53674..53940 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
N7Q99_RS26450 (N7Q99_26450) 53928..54410 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
N7Q99_RS26455 (N7Q99_26455) 54618..55964 + 1347 WP_077253535.1 ISNCY family transposase -
N7Q99_RS26460 (N7Q99_26460) 56013..56408 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
N7Q99_RS26465 (N7Q99_26465) 56556..57721 - 1166 Protein_59 IS3 family transposase -
N7Q99_RS26470 (N7Q99_26470) 57898..58860 - 963 WP_004152113.1 zinc metalloprotease HtpX -
N7Q99_RS26475 (N7Q99_26475) 58847..59335 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / aac(6')-Ib-cr / blaOXA-1 / tet(A) / qnrB1 - 1..156780 156780


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T259153 WP_003026803.1 NZ_CP104767:53928-54410 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT259153 WP_003026799.1 NZ_CP104767:53674-53940 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References