Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4746002..4746705 | Replicon | chromosome |
| Accession | NZ_CP104766 | ||
| Organism | Klebsiella pneumoniae strain IMT44613 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | N7Q99_RS23100 | Protein ID | WP_071994632.1 |
| Coordinates | 4746002..4746343 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | N7Q99_RS23105 | Protein ID | WP_032434296.1 |
| Coordinates | 4746364..4746705 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7Q99_RS23090 (4742317) | 4742317..4743186 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| N7Q99_RS23095 (4743777) | 4743777..4745810 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
| N7Q99_RS23100 (4746002) | 4746002..4746343 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| N7Q99_RS23105 (4746364) | 4746364..4746705 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N7Q99_RS23110 (4746716) | 4746716..4747258 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| N7Q99_RS23115 (4747271) | 4747271..4747711 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| N7Q99_RS23120 (4747742) | 4747742..4748563 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| N7Q99_RS23125 (4748683) | 4748683..4749156 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| N7Q99_RS23130 (4749228) | 4749228..4749680 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| N7Q99_RS23135 (4749716) | 4749716..4750432 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| N7Q99_RS23140 (4750676) | 4750676..4751550 | - | 875 | Protein_4533 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4734299..4779972 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T259149 WP_071994632.1 NZ_CP104766:c4746343-4746002 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|