Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4073639..4074258 Replicon chromosome
Accession NZ_CP104766
Organism Klebsiella pneumoniae strain IMT44613

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N7Q99_RS19885 Protein ID WP_002892050.1
Coordinates 4074040..4074258 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N7Q99_RS19880 Protein ID WP_002892066.1
Coordinates 4073639..4074013 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7Q99_RS19870 (4068791) 4068791..4069984 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N7Q99_RS19875 (4070007) 4070007..4073153 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N7Q99_RS19880 (4073639) 4073639..4074013 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N7Q99_RS19885 (4074040) 4074040..4074258 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N7Q99_RS19890 (4074417) 4074417..4074983 + 567 Protein_3899 maltose O-acetyltransferase -
N7Q99_RS19895 (4074955) 4074955..4075095 - 141 WP_004147370.1 hypothetical protein -
N7Q99_RS19900 (4075116) 4075116..4075586 + 471 WP_002892026.1 YlaC family protein -
N7Q99_RS19905 (4075561) 4075561..4077012 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
N7Q99_RS19910 (4077113) 4077113..4077811 + 699 WP_032435564.1 GNAT family protein -
N7Q99_RS19915 (4077808) 4077808..4077948 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N7Q99_RS19920 (4077948) 4077948..4078211 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T259147 WP_002892050.1 NZ_CP104766:4074040-4074258 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT259147 WP_002892066.1 NZ_CP104766:4073639-4074013 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References