Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 743870..744494 | Replicon | chromosome |
| Accession | NZ_CP104764 | ||
| Organism | Enterococcus raffinosus strain Er676 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | R2RF59 |
| Locus tag | N7K39_RS03680 | Protein ID | WP_010746644.1 |
| Coordinates | 744309..744494 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | R2QSL8 |
| Locus tag | N7K39_RS03675 | Protein ID | WP_010746645.1 |
| Coordinates | 743870..744256 (-) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7K39_RS03650 (N7K39_03650) | 739492..739827 | + | 336 | WP_010746650.1 | hypothetical protein | - |
| N7K39_RS03655 (N7K39_03655) | 740195..740668 | + | 474 | WP_010746649.1 | hypothetical protein | - |
| N7K39_RS03660 (N7K39_03660) | 740672..741886 | + | 1215 | WP_010746648.1 | biotin/lipoyl-binding protein | - |
| N7K39_RS03665 (N7K39_03665) | 741887..742573 | + | 687 | WP_010746647.1 | ABC transporter ATP-binding protein | - |
| N7K39_RS03670 (N7K39_03670) | 742570..743769 | + | 1200 | WP_010746646.1 | ABC transporter permease | - |
| N7K39_RS03675 (N7K39_03675) | 743870..744256 | - | 387 | WP_010746645.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N7K39_RS03680 (N7K39_03680) | 744309..744494 | - | 186 | WP_010746644.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N7K39_RS03685 (N7K39_03685) | 744729..745664 | - | 936 | WP_010746643.1 | membrane protein insertase YidC | - |
| N7K39_RS03690 (N7K39_03690) | 745769..746041 | - | 273 | WP_010746642.1 | acylphosphatase | - |
| N7K39_RS03695 (N7K39_03695) | 746181..746942 | + | 762 | WP_010746641.1 | RNA methyltransferase | - |
| N7K39_RS03700 (N7K39_03700) | 747073..747570 | + | 498 | WP_010746640.1 | HD domain-containing protein | - |
| N7K39_RS03705 (N7K39_03705) | 747938..748570 | + | 633 | WP_010746639.1 | YitT family protein | - |
| N7K39_RS03710 (N7K39_03710) | 748743..749306 | + | 564 | WP_010746638.1 | elongation factor P | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7029.19 Da Isoelectric Point: 10.5745
>T259135 WP_010746644.1 NZ_CP104764:c744494-744309 [Enterococcus raffinosus]
MDAKELAKILKNDGWYFDSQRGSHRYYKHPIKKGKVPVPFHSHKDIPIGTLNNILKQAGLK
MDAKELAKILKNDGWYFDSQRGSHRYYKHPIKKGKVPVPFHSHKDIPIGTLNNILKQAGLK
Download Length: 186 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 14319.38 Da Isoelectric Point: 4.4698
>AT259135 WP_010746645.1 NZ_CP104764:c744256-743870 [Enterococcus raffinosus]
MVIYYAMFDFADNGINVVFPDLNNAATFGENMHEALYMAKDLLAGWLIDAEDEKQAFPSPTDHRSLSVAAGNLLIPIEVD
LSFYRKKFESKPIKKTLTIPKYLNDLGNEAGINFSATLTEALKEKLEV
MVIYYAMFDFADNGINVVFPDLNNAATFGENMHEALYMAKDLLAGWLIDAEDEKQAFPSPTDHRSLSVAAGNLLIPIEVD
LSFYRKKFESKPIKKTLTIPKYLNDLGNEAGINFSATLTEALKEKLEV
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|