Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 656273..656856 | Replicon | plasmid p1_ATCC49464 |
| Accession | NZ_CP104763 | ||
| Organism | Enterococcus raffinosus strain ATCC 49464 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R2S2E9 |
| Locus tag | N7K38_RS19475 | Protein ID | WP_010743953.1 |
| Coordinates | 656512..656856 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R2RFE4 |
| Locus tag | N7K38_RS19470 | Protein ID | WP_010743954.1 |
| Coordinates | 656273..656518 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7K38_RS19440 (N7K38_19440) | 651494..652798 | + | 1305 | WP_010743959.1 | glycosyltransferase family 2 protein | - |
| N7K38_RS19445 (N7K38_19445) | 652925..654010 | + | 1086 | WP_141741229.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
| N7K38_RS19450 (N7K38_19450) | 654098..654190 | - | 93 | WP_111945260.1 | type I toxin-antitoxin system Fst family toxin | - |
| N7K38_RS19455 (N7K38_19455) | 654272..654889 | - | 618 | WP_010743957.1 | DUF2922 family protein | - |
| N7K38_RS19460 (N7K38_19460) | 654935..655319 | - | 385 | Protein_597 | hypothetical protein | - |
| N7K38_RS19465 (N7K38_19465) | 655728..655856 | + | 129 | WP_010743955.1 | hypothetical protein | - |
| N7K38_RS19470 (N7K38_19470) | 656273..656518 | + | 246 | WP_010743954.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| N7K38_RS19475 (N7K38_19475) | 656512..656856 | + | 345 | WP_010743953.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| N7K38_RS19480 (N7K38_19480) | 657304..657969 | + | 666 | WP_035015986.1 | helix-turn-helix domain-containing protein | - |
| N7K38_RS19485 (N7K38_19485) | 658463..659935 | + | 1473 | WP_010743951.1 | helix-turn-helix domain-containing protein | - |
| N7K38_RS19490 (N7K38_19490) | 659952..660731 | + | 780 | WP_010743950.1 | AP2 domain-containing protein | - |
| N7K38_RS19495 (N7K38_19495) | 660831..661244 | + | 414 | WP_010743949.1 | Ohr family peroxiredoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | bsh | 1..1021776 | 1021776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13217.40 Da Isoelectric Point: 9.2981
>T259134 WP_010743953.1 NZ_CP104763:656512-656856 [Enterococcus raffinosus]
MVRMIKQGDIVKMNLDPKQGHEQKGYRPYICLSYKGVAMNSRIAIFAPISNTQRNYPLYVPVSAECKTTGKVLLDQLVAI
DFYHRDYSFVETVPDDFINDLLKKVKVIFQRDKE
MVRMIKQGDIVKMNLDPKQGHEQKGYRPYICLSYKGVAMNSRIAIFAPISNTQRNYPLYVPVSAECKTTGKVLLDQLVAI
DFYHRDYSFVETVPDDFINDLLKKVKVIFQRDKE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|