Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 784237..784861 Replicon chromosome
Accession NZ_CP104762
Organism Enterococcus raffinosus strain ATCC 49464

Toxin (Protein)


Gene name hicA Uniprot ID R2RF59
Locus tag N7K38_RS03995 Protein ID WP_010746644.1
Coordinates 784676..784861 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID R2QSL8
Locus tag N7K38_RS03990 Protein ID WP_010746645.1
Coordinates 784237..784623 (-) Length 129 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7K38_RS03965 (779859) 779859..780194 + 336 WP_010746650.1 hypothetical protein -
N7K38_RS03970 (780562) 780562..781035 + 474 WP_010746649.1 hypothetical protein -
N7K38_RS03975 (781039) 781039..782253 + 1215 WP_010746648.1 biotin/lipoyl-binding protein -
N7K38_RS03980 (782254) 782254..782940 + 687 WP_010746647.1 ABC transporter ATP-binding protein -
N7K38_RS03985 (782937) 782937..784136 + 1200 WP_010746646.1 ABC transporter permease -
N7K38_RS03990 (784237) 784237..784623 - 387 WP_010746645.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N7K38_RS03995 (784676) 784676..784861 - 186 WP_010746644.1 type II toxin-antitoxin system HicA family toxin Toxin
N7K38_RS04000 (785096) 785096..786031 - 936 WP_010746643.1 membrane protein insertase YidC -
N7K38_RS04005 (786136) 786136..786408 - 273 WP_010746642.1 acylphosphatase -
N7K38_RS04010 (786548) 786548..787309 + 762 WP_010746641.1 RNA methyltransferase -
N7K38_RS04015 (787440) 787440..787937 + 498 WP_010746640.1 HD domain-containing protein -
N7K38_RS04020 (788305) 788305..788937 + 633 WP_010746639.1 YitT family protein -
N7K38_RS04025 (789110) 789110..789673 + 564 WP_010746638.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(12-93)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7029.19 Da        Isoelectric Point: 10.5745

>T259130 WP_010746644.1 NZ_CP104762:c784861-784676 [Enterococcus raffinosus]
MDAKELAKILKNDGWYFDSQRGSHRYYKHPIKKGKVPVPFHSHKDIPIGTLNNILKQAGLK

Download         Length: 186 bp

Antitoxin


Download         Length: 129 a.a.        Molecular weight: 14319.38 Da        Isoelectric Point: 4.4698

>AT259130 WP_010746645.1 NZ_CP104762:c784623-784237 [Enterococcus raffinosus]
MVIYYAMFDFADNGINVVFPDLNNAATFGENMHEALYMAKDLLAGWLIDAEDEKQAFPSPTDHRSLSVAAGNLLIPIEVD
LSFYRKKFESKPIKKTLTIPKYLNDLGNEAGINFSATLTEALKEKLEV

Download         Length: 387 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R2RF59

Antitoxin

Source ID Structure
AlphaFold DB R2QSL8

References