259129

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 340177..340851 Replicon chromosome
Accession NZ_CP104762
Organism Enterococcus raffinosus strain ATCC 49464

Toxin (Protein)


Gene name hicA Uniprot ID R2NPY8
Locus tag N7K38_RS01785 Protein ID WP_010747075.1
Coordinates 340663..340851 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID R2NSW8
Locus tag N7K38_RS01780 Protein ID WP_010747076.1
Coordinates 340177..340629 (-) Length 151 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7K38_RS01710 (336112) 336112..336288 + 177 WP_167325168.1 hypothetical protein -
N7K38_RS01715 (336260) 336260..336751 + 492 WP_010747089.1 DUF1064 domain-containing protein -
N7K38_RS01720 (336738) 336738..336935 + 198 WP_010747088.1 hypothetical protein -
N7K38_RS01725 (336928) 336928..337251 + 324 WP_010747087.1 hypothetical protein -
N7K38_RS01730 (337241) 337241..337492 + 252 WP_010747086.1 DUF3850 domain-containing protein -
N7K38_RS01735 (337494) 337494..337658 + 165 WP_010747085.1 hypothetical protein -
N7K38_RS01740 (337646) 337646..337858 + 213 WP_010747084.1 hypothetical protein -
N7K38_RS01745 (337834) 337834..337989 + 156 WP_010747083.1 hypothetical protein -
N7K38_RS01750 (338018) 338018..338314 + 297 WP_035015722.1 hypothetical protein -
N7K38_RS01755 (338358) 338358..338504 + 147 WP_010747081.1 hypothetical protein -
N7K38_RS01760 (338505) 338505..338783 + 279 WP_010747080.1 hypothetical protein -
N7K38_RS01765 (338830) 338830..339108 + 279 WP_010747079.1 DUF6275 family protein -
N7K38_RS01770 (339286) 339286..339708 + 423 WP_010747077.1 ArpU family phage packaging/lysis transcriptional regulator -
N7K38_RS01775 (339903) 339903..339986 + 84 WP_219924597.1 putative holin-like toxin -
N7K38_RS01780 (340177) 340177..340629 - 453 WP_010747076.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N7K38_RS01785 (340663) 340663..340851 - 189 WP_010747075.1 type II toxin-antitoxin system HicA family toxin Toxin
N7K38_RS01790 (341190) 341190..341618 + 429 WP_010747074.1 hypothetical protein -
N7K38_RS01795 (341596) 341596..343041 + 1446 WP_010747073.1 phage terminase large subunit -
N7K38_RS01800 (343055) 343055..344587 + 1533 WP_035015857.1 phage portal protein -
N7K38_RS01805 (344556) 344556..345491 + 936 WP_010747071.1 minor capsid protein -
N7K38_RS01810 (345475) 345475..345702 + 228 WP_010747070.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 326911..361640 34729


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-61)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(19-117)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 6912.21 Da        Isoelectric Point: 10.8174

>T259129 WP_010747075.1 NZ_CP104762:c340851-340663 [Enterococcus raffinosus]
MPMTQREMVKLLKSHGFKKVGDEGKGSHVKMTKPGQARPIIIPHGELNKYTERGIKKDAGLL

Download         Length: 189 bp

Antitoxin


Download         Length: 151 a.a.        Molecular weight: 16899.03 Da        Isoelectric Point: 4.2130

>AT259129 WP_010747076.1 NZ_CP104762:c340629-340177 [Enterococcus raffinosus]
MLVTYPALFYYDDTDKTSVPYSVFFPDIHYGATQGENISDAMSMASEFLGIAVASMVEDNEKVPTPSNIHNLSLVDNNPF
IDDKDFDLQFDPEKSFISMVTVDISQYLGEQEPVKKTLTIPKWADRLGKELHLNFSKTLTDAIANKHIEV

Download         Length: 453 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R2NPY8

Antitoxin

Source ID Structure
AlphaFold DB R2NSW8

References