Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 340177..340851 | Replicon | chromosome |
| Accession | NZ_CP104762 | ||
| Organism | Enterococcus raffinosus strain ATCC 49464 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | R2NPY8 |
| Locus tag | N7K38_RS01785 | Protein ID | WP_010747075.1 |
| Coordinates | 340663..340851 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | R2NSW8 |
| Locus tag | N7K38_RS01780 | Protein ID | WP_010747076.1 |
| Coordinates | 340177..340629 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7K38_RS01710 (336112) | 336112..336288 | + | 177 | WP_167325168.1 | hypothetical protein | - |
| N7K38_RS01715 (336260) | 336260..336751 | + | 492 | WP_010747089.1 | DUF1064 domain-containing protein | - |
| N7K38_RS01720 (336738) | 336738..336935 | + | 198 | WP_010747088.1 | hypothetical protein | - |
| N7K38_RS01725 (336928) | 336928..337251 | + | 324 | WP_010747087.1 | hypothetical protein | - |
| N7K38_RS01730 (337241) | 337241..337492 | + | 252 | WP_010747086.1 | DUF3850 domain-containing protein | - |
| N7K38_RS01735 (337494) | 337494..337658 | + | 165 | WP_010747085.1 | hypothetical protein | - |
| N7K38_RS01740 (337646) | 337646..337858 | + | 213 | WP_010747084.1 | hypothetical protein | - |
| N7K38_RS01745 (337834) | 337834..337989 | + | 156 | WP_010747083.1 | hypothetical protein | - |
| N7K38_RS01750 (338018) | 338018..338314 | + | 297 | WP_035015722.1 | hypothetical protein | - |
| N7K38_RS01755 (338358) | 338358..338504 | + | 147 | WP_010747081.1 | hypothetical protein | - |
| N7K38_RS01760 (338505) | 338505..338783 | + | 279 | WP_010747080.1 | hypothetical protein | - |
| N7K38_RS01765 (338830) | 338830..339108 | + | 279 | WP_010747079.1 | DUF6275 family protein | - |
| N7K38_RS01770 (339286) | 339286..339708 | + | 423 | WP_010747077.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| N7K38_RS01775 (339903) | 339903..339986 | + | 84 | WP_219924597.1 | putative holin-like toxin | - |
| N7K38_RS01780 (340177) | 340177..340629 | - | 453 | WP_010747076.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N7K38_RS01785 (340663) | 340663..340851 | - | 189 | WP_010747075.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N7K38_RS01790 (341190) | 341190..341618 | + | 429 | WP_010747074.1 | hypothetical protein | - |
| N7K38_RS01795 (341596) | 341596..343041 | + | 1446 | WP_010747073.1 | phage terminase large subunit | - |
| N7K38_RS01800 (343055) | 343055..344587 | + | 1533 | WP_035015857.1 | phage portal protein | - |
| N7K38_RS01805 (344556) | 344556..345491 | + | 936 | WP_010747071.1 | minor capsid protein | - |
| N7K38_RS01810 (345475) | 345475..345702 | + | 228 | WP_010747070.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 326911..361640 | 34729 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6912.21 Da Isoelectric Point: 10.8174
>T259129 WP_010747075.1 NZ_CP104762:c340851-340663 [Enterococcus raffinosus]
MPMTQREMVKLLKSHGFKKVGDEGKGSHVKMTKPGQARPIIIPHGELNKYTERGIKKDAGLL
MPMTQREMVKLLKSHGFKKVGDEGKGSHVKMTKPGQARPIIIPHGELNKYTERGIKKDAGLL
Download Length: 189 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16899.03 Da Isoelectric Point: 4.2130
>AT259129 WP_010747076.1 NZ_CP104762:c340629-340177 [Enterococcus raffinosus]
MLVTYPALFYYDDTDKTSVPYSVFFPDIHYGATQGENISDAMSMASEFLGIAVASMVEDNEKVPTPSNIHNLSLVDNNPF
IDDKDFDLQFDPEKSFISMVTVDISQYLGEQEPVKKTLTIPKWADRLGKELHLNFSKTLTDAIANKHIEV
MLVTYPALFYYDDTDKTSVPYSVFFPDIHYGATQGENISDAMSMASEFLGIAVASMVEDNEKVPTPSNIHNLSLVDNNPF
IDDKDFDLQFDPEKSFISMVTVDISQYLGEQEPVKKTLTIPKWADRLGKELHLNFSKTLTDAIANKHIEV
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|