Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 5755..6398 Replicon plasmid pGABEKP28_3
Accession NZ_CP104761
Organism Kalamiella piersonii strain GABEKP28

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag N5580_RS21840 Protein ID WP_103061444.1
Coordinates 5982..6398 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A2K1Q4F2
Locus tag N5580_RS21835 Protein ID WP_031378113.1
Coordinates 5755..5985 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5580_RS21810 (N5580_21810) 764..1558 - 795 WP_069730047.1 ParA family protein -
N5580_RS21815 (N5580_21815) 1772..2455 + 684 WP_069730048.1 hypothetical protein -
N5580_RS21820 (N5580_21820) 3367..4134 - 768 WP_103797669.1 site-specific integrase -
N5580_RS21825 (N5580_21825) 4197..4850 - 654 WP_233215900.1 hypothetical protein -
N5580_RS21830 (N5580_21830) 4902..5207 - 306 WP_094121214.1 hypothetical protein -
N5580_RS21835 (N5580_21835) 5755..5985 + 231 WP_031378113.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5580_RS21840 (N5580_21840) 5982..6398 + 417 WP_103061444.1 type II toxin-antitoxin system VapC family toxin Toxin
N5580_RS21845 (N5580_21845) 6530..7435 - 906 Protein_9 LysR family transcriptional regulator -
N5580_RS21850 (N5580_21850) 7533..8060 + 528 WP_094121212.1 GNAT family N-acetyltransferase -
N5580_RS21855 (N5580_21855) 8057..8719 + 663 WP_233215901.1 MFS transporter -
N5580_RS21860 (N5580_21860) 8827..9282 + 456 WP_238585885.1 hypothetical protein -
N5580_RS21865 (N5580_21865) 9331..9663 + 333 WP_007749362.1 metalloregulator ArsR/SmtB family transcription factor -
N5580_RS21870 (N5580_21870) 9669..10382 + 714 WP_031374857.1 arsenical resistance protein ArsH -
N5580_RS21875 (N5580_21875) 10449..10877 - 429 WP_031374858.1 glutaredoxin-dependent arsenate reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..106029 106029


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-54)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15263.50 Da        Isoelectric Point: 6.4571

>T259128 WP_103061444.1 NZ_CP104761:5982-6398 [Kalamiella piersonii]
VNKTYMLDTCICSFIMREQPEAVRKRLEQAVLRGNRIVISAITYQEMRFGATGPKASPRHVQLVDEFCTRLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAISADAVLVTNNTREFERVPGLALEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8857.93 Da        Isoelectric Point: 4.2917

>AT259128 WP_031378113.1 NZ_CP104761:5755-5985 [Kalamiella piersonii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWNSFFELEKADPDFMAEREDVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2K1Q4F2

References