Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2836060..2836679 | Replicon | chromosome |
| Accession | NZ_CP104758 | ||
| Organism | Kalamiella piersonii strain GABEKP28 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | N5580_RS13590 | Protein ID | WP_120451305.1 |
| Coordinates | 2836461..2836679 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | N5580_RS13585 | Protein ID | WP_120451306.1 |
| Coordinates | 2836060..2836437 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5580_RS13555 (2832368) | 2832368..2832619 | + | 252 | WP_120451311.1 | type B 50S ribosomal protein L31 | - |
| N5580_RS13560 (2832631) | 2832631..2832771 | + | 141 | WP_071997379.1 | type B 50S ribosomal protein L36 | - |
| N5580_RS13565 (2832813) | 2832813..2833691 | - | 879 | WP_120451310.1 | metal ABC transporter substrate-binding protein | - |
| N5580_RS13570 (2833704) | 2833704..2834543 | - | 840 | WP_269949393.1 | metal ABC transporter permease | - |
| N5580_RS13575 (2834540) | 2834540..2835205 | - | 666 | WP_269950357.1 | ABC transporter ATP-binding protein | - |
| N5580_RS13580 (2835558) | 2835558..2835911 | + | 354 | WP_269949394.1 | hypothetical protein | - |
| N5580_RS13585 (2836060) | 2836060..2836437 | + | 378 | WP_120451306.1 | Hha toxicity modulator TomB | Antitoxin |
| N5580_RS13590 (2836461) | 2836461..2836679 | + | 219 | WP_120451305.1 | HHA domain-containing protein | Toxin |
| N5580_RS13600 (2837066) | 2837066..2837377 | + | 312 | WP_120451304.1 | MGMT family protein | - |
| N5580_RS13605 (2837410) | 2837410..2837967 | - | 558 | WP_269949395.1 | YbaY family lipoprotein | - |
| N5580_RS13610 (2838157) | 2838157..2839020 | + | 864 | WP_120451302.1 | acyl-CoA thioesterase II | - |
| N5580_RS13615 (2839139) | 2839139..2840431 | - | 1293 | WP_120451301.1 | ammonium transporter AmtB | - |
| N5580_RS13620 (2840465) | 2840465..2840803 | - | 339 | WP_033752690.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8601.92 Da Isoelectric Point: 8.9007
>T259126 WP_120451305.1 NZ_CP104758:2836461-2836679 [Kalamiella piersonii]
MNDKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
MNDKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14763.31 Da Isoelectric Point: 4.3276
>AT259126 WP_120451306.1 NZ_CP104758:2836060-2836437 [Kalamiella piersonii]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSENNLQLNDLIEHIASFTMNYKIKHAEDEDLITQIDDYL
DDTFMLFTNYGINAQDLNRWQRSARRLFNLFSEECAYLQQPSHSI
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSENNLQLNDLIEHIASFTMNYKIKHAEDEDLITQIDDYL
DDTFMLFTNYGINAQDLNRWQRSARRLFNLFSEECAYLQQPSHSI
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|