Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-MqsA |
| Location | 47899..48598 | Replicon | chromosome |
| Accession | NZ_CP104758 | ||
| Organism | Kalamiella piersonii strain GABEKP28 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N5580_RS00215 | Protein ID | WP_269949705.1 |
| Coordinates | 47899..48288 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N5580_RS00220 | Protein ID | WP_126690121.1 |
| Coordinates | 48281..48598 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5580_RS00200 (43534) | 43534..44529 | - | 996 | WP_120457791.1 | acyltransferase | - |
| N5580_RS00205 (44722) | 44722..45633 | + | 912 | WP_120457793.1 | glycine--tRNA ligase subunit alpha | - |
| N5580_RS00210 (45643) | 45643..47712 | + | 2070 | WP_269949704.1 | glycine--tRNA ligase subunit beta | - |
| N5580_RS00215 (47899) | 47899..48288 | + | 390 | WP_269949705.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5580_RS00220 (48281) | 48281..48598 | + | 318 | WP_126690121.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N5580_RS00225 (48783) | 48783..49394 | - | 612 | WP_269949706.1 | glutathione S-transferase | - |
| N5580_RS00230 (49421) | 49421..50347 | - | 927 | WP_126690119.1 | formate dehydrogenase accessory protein FdhE | - |
| N5580_RS00235 (50347) | 50347..50988 | - | 642 | WP_269949707.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5580_RS00240 (50985) | 50985..51869 | - | 885 | WP_126690117.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15046.29 Da Isoelectric Point: 5.8545
>T259121 WP_269949705.1 NZ_CP104758:47899-48288 [Kalamiella piersonii]
MGIYLTPEFDEERRRLGITDKVICKTARKVYSGLKGDQLGKFTYKRRIALSKVGERGGARSIVFFNEGEHLYFFYLYAKS
ELSKKKGKEIEDAEIEIFCDIASDFIEMDDARIKHLLEEKELFEVKCDE
MGIYLTPEFDEERRRLGITDKVICKTARKVYSGLKGDQLGKFTYKRRIALSKVGERGGARSIVFFNEGEHLYFFYLYAKS
ELSKKKGKEIEDAEIEIFCDIASDFIEMDDARIKHLLEEKELFEVKCDE
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|