Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 3045878..3046603 | Replicon | chromosome |
| Accession | NZ_CP104757 | ||
| Organism | Pectobacterium aroidearum strain QJ021 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | N5056_RS13570 | Protein ID | WP_181838212.1 |
| Coordinates | 3045878..3046198 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N5056_RS13575 | Protein ID | WP_110162281.1 |
| Coordinates | 3046268..3046603 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5056_RS13540 (N5056_13540) | 3041071..3041274 | - | 204 | WP_015840819.1 | protein DsrB | - |
| N5056_RS13545 (N5056_13545) | 3041485..3042900 | + | 1416 | WP_181828896.1 | diguanylate cyclase | - |
| N5056_RS13550 (N5056_13550) | 3043172..3043390 | + | 219 | WP_180777774.1 | KTSC domain-containing protein | - |
| N5056_RS13555 (N5056_13555) | 3043617..3043973 | + | 357 | WP_181828897.1 | hypothetical protein | - |
| N5056_RS13560 (N5056_13560) | 3044562..3044804 | - | 243 | WP_181838213.1 | hypothetical protein | - |
| N5056_RS13565 (N5056_13565) | 3044927..3045760 | - | 834 | WP_181838219.1 | DUF4942 domain-containing protein | - |
| N5056_RS13570 (N5056_13570) | 3045878..3046198 | - | 321 | WP_181838212.1 | TA system toxin CbtA family protein | Toxin |
| N5056_RS13575 (N5056_13575) | 3046268..3046603 | - | 336 | WP_110162281.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5056_RS13580 (N5056_13580) | 3046643..3047116 | - | 474 | WP_181838211.1 | DNA repair protein RadC | - |
| N5056_RS13585 (N5056_13585) | 3047239..3047589 | - | 351 | WP_005974477.1 | hypothetical protein | - |
| N5056_RS13590 (N5056_13590) | 3047647..3048480 | - | 834 | WP_181838210.1 | hypothetical protein | - |
| N5056_RS13595 (N5056_13595) | 3048627..3048785 | - | 159 | WP_155242703.1 | hypothetical protein | - |
| N5056_RS13600 (N5056_13600) | 3048969..3049856 | - | 888 | WP_181838209.1 | 50S ribosome-binding GTPase | - |
| N5056_RS13605 (N5056_13605) | 3049952..3050983 | - | 1032 | WP_181838208.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | hcp / vgrG2 | 3044301..3124878 | 80577 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12098.83 Da Isoelectric Point: 4.6104
>T259120 WP_181838212.1 NZ_CP104757:c3046198-3045878 [Pectobacterium aroidearum]
MQTIPEIPSREEQSCPSPIAVWQQLLTYLLEKHYGLTLNDTPFCEENVIQAHIDAGVTLVNAVNFLVEKYELVRIDRDGF
NWQEQSPFLTAVDILRARRATGLLKA
MQTIPEIPSREEQSCPSPIAVWQQLLTYLLEKHYGLTLNDTPFCEENVIQAHIDAGVTLVNAVNFLVEKYELVRIDRDGF
NWQEQSPFLTAVDILRARRATGLLKA
Download Length: 321 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12355.07 Da Isoelectric Point: 6.2085
>AT259120 WP_110162281.1 NZ_CP104757:c3046603-3046268 [Pectobacterium aroidearum]
MSSIEAPEWGLKCTVTPRFGARLVQEGNRLHYLADRASIVGTFSKTEARHLERCFPQLIKQLEQKLCTGELNPRQQGCVT
LHCDEFTCEADTLGSFGYVYIAIYPSAAAAE
MSSIEAPEWGLKCTVTPRFGARLVQEGNRLHYLADRASIVGTFSKTEARHLERCFPQLIKQLEQKLCTGELNPRQQGCVT
LHCDEFTCEADTLGSFGYVYIAIYPSAAAAE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|