Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1876705..1877275 | Replicon | chromosome |
Accession | NZ_CP104757 | ||
Organism | Pectobacterium aroidearum strain QJ021 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N5056_RS08335 | Protein ID | WP_181838233.1 |
Coordinates | 1876991..1877275 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5056_RS08330 | Protein ID | WP_181838234.1 |
Coordinates | 1876705..1876944 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5056_RS08300 (N5056_08300) | 1872640..1873176 | + | 537 | WP_181828281.1 | rhodanese family protein | - |
N5056_RS08305 (N5056_08305) | 1873242..1873571 | + | 330 | WP_181828282.1 | DHCW motif cupin fold protein | - |
N5056_RS08310 (N5056_08310) | 1873806..1874270 | + | 465 | WP_181828283.1 | GyrI-like domain-containing protein | - |
N5056_RS08315 (N5056_08315) | 1874430..1875308 | - | 879 | WP_181828284.1 | cell envelope biogenesis protein OmpA | - |
N5056_RS08320 (N5056_08320) | 1875926..1876051 | - | 126 | WP_258876276.1 | hypothetical protein | - |
N5056_RS08325 (N5056_08325) | 1876288..1876647 | - | 360 | WP_181838235.1 | hypothetical protein | - |
N5056_RS08330 (N5056_08330) | 1876705..1876944 | - | 240 | WP_181838234.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N5056_RS08335 (N5056_08335) | 1876991..1877275 | - | 285 | WP_181838233.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5056_RS08340 (N5056_08340) | 1877265..1877510 | - | 246 | WP_010286544.1 | CopG family ribbon-helix-helix protein | - |
N5056_RS08345 (N5056_08345) | 1878029..1878961 | + | 933 | WP_181838232.1 | hypothetical protein | - |
N5056_RS08350 (N5056_08350) | 1878958..1879512 | + | 555 | WP_181838231.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11067.89 Da Isoelectric Point: 10.2808
>T259119 WP_181838233.1 NZ_CP104757:c1877275-1876991 [Pectobacterium aroidearum]
MEIKWLRKAAANLEAEYRYIAQDDPQAASQFVDEVQRLTELLPQQPAMGRPGRVPGTRELVLTHYPYIIPYRVKGNMLQI
LRIFHTHRRLPAKW
MEIKWLRKAAANLEAEYRYIAQDDPQAASQFVDEVQRLTELLPQQPAMGRPGRVPGTRELVLTHYPYIIPYRVKGNMLQI
LRIFHTHRRLPAKW
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|