Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 1752298..1752851 | Replicon | chromosome |
| Accession | NZ_CP104757 | ||
| Organism | Pectobacterium aroidearum strain QJ021 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | N5056_RS07715 | Protein ID | WP_181829556.1 |
| Coordinates | 1752537..1752851 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | C6CEY1 |
| Locus tag | N5056_RS07710 | Protein ID | WP_012769207.1 |
| Coordinates | 1752298..1752534 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5056_RS07695 (N5056_07695) | 1747388..1748704 | - | 1317 | WP_181829554.1 | ATP-binding protein | - |
| N5056_RS07700 (N5056_07700) | 1748708..1751017 | - | 2310 | WP_181829555.1 | TerB N-terminal domain-containing protein | - |
| N5056_RS07705 (N5056_07705) | 1751780..1752115 | + | 336 | Protein_1508 | ArdC family protein | - |
| N5056_RS07710 (N5056_07710) | 1752298..1752534 | + | 237 | WP_012769207.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| N5056_RS07715 (N5056_07715) | 1752537..1752851 | + | 315 | WP_181829556.1 | CcdB family protein | Toxin |
| N5056_RS07720 (N5056_07720) | 1752885..1752986 | - | 102 | Protein_1511 | mobilization protein mobC | - |
| N5056_RS07725 (N5056_07725) | 1752986..1753150 | - | 165 | Protein_1512 | Arm DNA-binding domain-containing protein | - |
| N5056_RS07735 (N5056_07735) | 1753511..1754308 | - | 798 | WP_181829557.1 | DgsA anti-repressor MtfA | - |
| N5056_RS07745 (N5056_07745) | 1754550..1754936 | - | 387 | WP_015839750.1 | lysozyme inhibitor LprI family protein | - |
| N5056_RS07750 (N5056_07750) | 1755112..1755279 | + | 168 | WP_015839751.1 | YqaE/Pmp3 family membrane protein | - |
| N5056_RS07755 (N5056_07755) | 1755364..1756785 | - | 1422 | WP_181829558.1 | DASS family sodium-coupled anion symporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11551.48 Da Isoelectric Point: 7.9859
>T259118 WP_181829556.1 NZ_CP104757:1752537-1752851 [Pectobacterium aroidearum]
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYTVMTHELASIPVQALG
AVFCDASQYRSQVKAAIDFLIDGF
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYTVMTHELASIPVQALG
AVFCDASQYRSQVKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|