Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1216559..1217184 | Replicon | chromosome |
Accession | NZ_CP104757 | ||
Organism | Pectobacterium aroidearum strain QJ021 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | C6DB72 |
Locus tag | N5056_RS05385 | Protein ID | WP_005976087.1 |
Coordinates | 1216559..1216762 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | C6DB73 |
Locus tag | N5056_RS05390 | Protein ID | WP_005976089.1 |
Coordinates | 1216816..1217184 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5056_RS05355 (N5056_05355) | 1212001..1212339 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
N5056_RS05360 (N5056_05360) | 1212377..1213663 | + | 1287 | WP_015839357.1 | ammonium transporter AmtB | - |
N5056_RS05365 (N5056_05365) | 1213816..1214679 | - | 864 | WP_015839358.1 | acyl-CoA thioesterase II | - |
N5056_RS05370 (N5056_05370) | 1214892..1215473 | + | 582 | WP_181830022.1 | YbaY family lipoprotein | - |
N5056_RS05375 (N5056_05375) | 1215493..1215813 | - | 321 | WP_015839360.1 | MGMT family protein | - |
N5056_RS05385 (N5056_05385) | 1216559..1216762 | - | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
N5056_RS05390 (N5056_05390) | 1216816..1217184 | - | 369 | WP_005976089.1 | Hha toxicity modulator TomB | Antitoxin |
N5056_RS05395 (N5056_05395) | 1217781..1217924 | - | 144 | WP_005976091.1 | type B 50S ribosomal protein L36 | - |
N5056_RS05400 (N5056_05400) | 1217942..1218190 | - | 249 | WP_181830023.1 | type B 50S ribosomal protein L31 | - |
N5056_RS05405 (N5056_05405) | 1218425..1221553 | - | 3129 | WP_015839362.1 | efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T259117 WP_005976087.1 NZ_CP104757:c1216762-1216559 [Pectobacterium aroidearum]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14032.77 Da Isoelectric Point: 4.4787
>AT259117 WP_005976089.1 NZ_CP104757:c1217184-1216816 [Pectobacterium aroidearum]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7Z3F0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7Z3G5 |