Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 747566..748226 | Replicon | chromosome |
Accession | NZ_CP104757 | ||
Organism | Pectobacterium aroidearum strain QJ021 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | N5056_RS03365 | Protein ID | WP_043881709.1 |
Coordinates | 747852..748226 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | C6D8Y5 |
Locus tag | N5056_RS03360 | Protein ID | WP_012773340.1 |
Coordinates | 747566..747832 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5056_RS03340 (N5056_03340) | 743558..744562 | - | 1005 | WP_181829660.1 | LacI family DNA-binding transcriptional regulator | - |
N5056_RS03345 (N5056_03345) | 744606..745214 | - | 609 | WP_181829659.1 | HD domain-containing protein | - |
N5056_RS03350 (N5056_03350) | 745627..746274 | + | 648 | WP_181829658.1 | hemolysin III family protein | - |
N5056_RS03355 (N5056_03355) | 746329..747330 | - | 1002 | WP_181829657.1 | tRNA-modifying protein YgfZ | - |
N5056_RS03360 (N5056_03360) | 747566..747832 | + | 267 | WP_012773340.1 | FAD assembly factor SdhE | Antitoxin |
N5056_RS03365 (N5056_03365) | 747852..748226 | + | 375 | WP_043881709.1 | protein YgfX | Toxin |
N5056_RS03370 (N5056_03370) | 748296..749231 | + | 936 | WP_181829656.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
N5056_RS03375 (N5056_03375) | 749277..749600 | - | 324 | WP_180777498.1 | hypothetical protein | - |
N5056_RS03380 (N5056_03380) | 749629..750147 | - | 519 | WP_012773344.1 | flavodoxin FldB | - |
N5056_RS03385 (N5056_03385) | 750310..751638 | - | 1329 | WP_012773346.1 | MFS transporter | - |
N5056_RS03390 (N5056_03390) | 751950..752849 | + | 900 | WP_012773347.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14673.34 Da Isoelectric Point: 10.6585
>T259116 WP_043881709.1 NZ_CP104757:747852-748226 [Pectobacterium aroidearum]
MQLLSLIVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDRQQLWLASDSMGDDEWRHLRQLLLQQKNWAR
MQLLSLIVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDRQQLWLASDSMGDDEWRHLRQLLLQQKNWAR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|