Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-DnaT |
Location | 353306..353876 | Replicon | chromosome |
Accession | NZ_CP104757 | ||
Organism | Pectobacterium aroidearum strain QJ021 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | N5056_RS01630 | Protein ID | WP_181829972.1 |
Coordinates | 353550..353876 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | - |
Locus tag | N5056_RS01625 | Protein ID | WP_180778477.1 |
Coordinates | 353306..353560 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5056_RS01600 (N5056_01600) | 348553..349143 | - | 591 | WP_012773024.1 | DnaA initiator-associating protein DiaA | - |
N5056_RS01605 (N5056_01605) | 349207..349602 | - | 396 | WP_181830009.1 | YraN family protein | - |
N5056_RS01610 (N5056_01610) | 349560..351578 | - | 2019 | WP_181829974.1 | penicillin-binding protein activator | - |
N5056_RS01615 (N5056_01615) | 351640..352527 | + | 888 | WP_181829973.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
N5056_RS01625 (N5056_01625) | 353306..353560 | + | 255 | WP_180778477.1 | plasmid stabilization protein | Antitoxin |
N5056_RS01630 (N5056_01630) | 353550..353876 | + | 327 | WP_181829972.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5056_RS01635 (N5056_01635) | 354001..354786 | + | 786 | WP_181829971.1 | 4,5-DOPA dioxygenase extradiol | - |
N5056_RS01640 (N5056_01640) | 354856..356016 | - | 1161 | WP_180778474.1 | glutathionylspermidine synthase family protein | - |
N5056_RS01645 (N5056_01645) | 356028..356702 | - | 675 | WP_012773030.1 | DUF1190 family protein | - |
N5056_RS01650 (N5056_01650) | 356969..358360 | - | 1392 | WP_181829970.1 | outer membrane channel protein TolC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12390.64 Da Isoelectric Point: 10.6902
>T259114 WP_181829972.1 NZ_CP104757:353550-353876 [Pectobacterium aroidearum]
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLVERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQVYSDTKSGLLRVIYSSSAVFLAV
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLVERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQVYSDTKSGLLRVIYSSSAVFLAV
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|