Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 234997..235614 | Replicon | chromosome |
| Accession | NZ_CP104757 | ||
| Organism | Pectobacterium aroidearum strain QJ021 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | C6DHN3 |
| Locus tag | N5056_RS01080 | Protein ID | WP_010281507.1 |
| Coordinates | 235435..235614 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N5056_RS01075 | Protein ID | WP_180779155.1 |
| Coordinates | 234997..235407 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5056_RS01060 (N5056_01060) | 230822..231865 | - | 1044 | WP_012772905.1 | DNA-binding transcriptional regulator CytR | - |
| N5056_RS01065 (N5056_01065) | 232142..234340 | - | 2199 | WP_181830192.1 | primosomal protein N' | - |
| N5056_RS01070 (N5056_01070) | 234655..234870 | + | 216 | WP_012772907.1 | 50S ribosomal protein L31 | - |
| N5056_RS01075 (N5056_01075) | 234997..235407 | - | 411 | WP_180779155.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N5056_RS01080 (N5056_01080) | 235435..235614 | - | 180 | WP_010281507.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N5056_RS01085 (N5056_01085) | 235712..236722 | - | 1011 | WP_181830191.1 | iron ABC transporter permease | - |
| N5056_RS01090 (N5056_01090) | 236719..237681 | - | 963 | WP_181830190.1 | ABC transporter substrate-binding protein | - |
| N5056_RS01095 (N5056_01095) | 237691..238488 | - | 798 | WP_181830189.1 | ABC transporter ATP-binding protein | - |
| N5056_RS01100 (N5056_01100) | 238704..239021 | - | 318 | WP_005973355.1 | met regulon transcriptional regulator MetJ | - |
| N5056_RS01105 (N5056_01105) | 239209..240369 | + | 1161 | WP_012772912.1 | cystathionine gamma-synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6560.69 Da Isoelectric Point: 10.7838
>T259113 WP_010281507.1 NZ_CP104757:c235614-235435 [Pectobacterium aroidearum]
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14492.36 Da Isoelectric Point: 4.3391
>AT259113 WP_180779155.1 NZ_CP104757:c235407-234997 [Pectobacterium aroidearum]
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAIANAKEAITGHIELLVEMGQDIPTVSTVGQLAKGSEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSSR
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAIANAKEAITGHIELLVEMGQDIPTVSTVGQLAKGSEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSSR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|