Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 197884..198518 | Replicon | chromosome |
Accession | NZ_CP104757 | ||
Organism | Pectobacterium aroidearum strain QJ021 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N5056_RS00910 | Protein ID | WP_181830242.1 |
Coordinates | 197884..198159 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5056_RS00915 | Protein ID | WP_181830203.1 |
Coordinates | 198156..198518 (+) | Length | 121 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5056_RS00875 (N5056_00875) | 192972..193037 | - | 66 | WP_228925434.1 | GpE family phage tail protein | - |
N5056_RS00880 (N5056_00880) | 193121..193441 | - | 321 | WP_039490576.1 | phage tail assembly protein | - |
N5056_RS00885 (N5056_00885) | 193448..193963 | - | 516 | WP_181838257.1 | phage major tail tube protein | - |
N5056_RS00890 (N5056_00890) | 193974..195167 | - | 1194 | WP_181838256.1 | phage tail sheath protein | - |
N5056_RS00895 (N5056_00895) | 195324..196457 | + | 1134 | WP_181838255.1 | phage late control D family protein | - |
N5056_RS00900 (N5056_00900) | 196508..196750 | + | 243 | WP_015840867.1 | ogr/Delta-like zinc finger family protein | - |
N5056_RS00905 (N5056_00905) | 196890..197633 | + | 744 | WP_181838254.1 | type VI secretion system-associated protein TagO | - |
N5056_RS00910 (N5056_00910) | 197884..198159 | + | 276 | WP_181830242.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N5056_RS00915 (N5056_00915) | 198156..198518 | + | 363 | WP_181830203.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N5056_RS00920 (N5056_00920) | 198893..200080 | + | 1188 | WP_180779137.1 | sugar transporter | - |
N5056_RS00925 (N5056_00925) | 200124..201026 | + | 903 | WP_181830202.1 | CDF family cation-efflux transporter FieF | - |
N5056_RS00930 (N5056_00930) | 201234..202196 | + | 963 | WP_012772882.1 | 6-phosphofructokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10037.61 Da Isoelectric Point: 11.1875
>T259112 WP_181830242.1 NZ_CP104757:197884-198159 [Pectobacterium aroidearum]
MQGKIASLRKKQRETLSQIFKTPVLSGVKWSNVESLITALGGEIKDGSGSRVRFLLNGSIARFHRPHPSPDTDKGALVNL
REWLESIGVKP
MQGKIASLRKKQRETLSQIFKTPVLSGVKWSNVESLITALGGEIKDGSGSRVRFLLNGSIARFHRPHPSPDTDKGALVNL
REWLESIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 121 a.a. Molecular weight: 13577.41 Da Isoelectric Point: 4.4981
>AT259112 WP_181830203.1 NZ_CP104757:198156-198518 [Pectobacterium aroidearum]
MTKALNTPNTMVVSGQPAIISYVPEIGMFRGKFIGLSGYCDFVADSINGLRNEGEISLREYLEDCQENGIEPYEREEKVK
TFTLRYPESFGERLTIAAAERQISVNTFIVETLNERMKQA
MTKALNTPNTMVVSGQPAIISYVPEIGMFRGKFIGLSGYCDFVADSINGLRNEGEISLREYLEDCQENGIEPYEREEKVK
TFTLRYPESFGERLTIAAAERQISVNTFIVETLNERMKQA
Download Length: 363 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|