Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 4333171..4333967 | Replicon | chromosome |
Accession | NZ_CP104755 | ||
Organism | Shewanella putrefaciens strain 4H |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A6N3J9I8 |
Locus tag | N5094_RS19185 | Protein ID | WP_011791158.1 |
Coordinates | 4333171..4333701 (-) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A6N3J9J2 |
Locus tag | N5094_RS19190 | Protein ID | WP_011791159.1 |
Coordinates | 4333698..4333967 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5094_RS19165 (N5094_19165) | 4329442..4330209 | - | 768 | WP_261762160.1 | class I SAM-dependent methyltransferase | - |
N5094_RS19170 (N5094_19170) | 4330489..4331262 | + | 774 | WP_014611771.1 | hypothetical protein | - |
N5094_RS19175 (N5094_19175) | 4331537..4332007 | + | 471 | WP_011791156.1 | hypothetical protein | - |
N5094_RS19180 (N5094_19180) | 4332070..4332762 | + | 693 | WP_014611773.1 | hypothetical protein | - |
N5094_RS19185 (N5094_19185) | 4333171..4333701 | - | 531 | WP_011791158.1 | GNAT family N-acetyltransferase | Toxin |
N5094_RS19190 (N5094_19190) | 4333698..4333967 | - | 270 | WP_011791159.1 | DUF1778 domain-containing protein | Antitoxin |
N5094_RS19195 (N5094_19195) | 4334253..4335209 | - | 957 | WP_261762161.1 | hypothetical protein | - |
N5094_RS19200 (N5094_19200) | 4335718..4336107 | - | 390 | WP_261762162.1 | GIY-YIG nuclease family protein | - |
N5094_RS19205 (N5094_19205) | 4336118..4338253 | - | 2136 | WP_261762163.1 | S9 family peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 19795.16 Da Isoelectric Point: 8.3330
>T259110 WP_011791158.1 NZ_CP104755:c4333701-4333171 [Shewanella putrefaciens]
VSYSKIFKELDKSLHDRVSFDCGEAELNDFIQTQAAKHMQAGISRTMVLPAAMPLPNQKYPICSFYTIAPSSICRDTLPQ
AIGKKLPRYPIPVFLLAQLAVHKEFHGSGLGKASLIKALEYLWEINAHMRAYAIVVDCLTDQAESFYAKYGFEVLCEING
RVRMFIPMKTVGQLFT
VSYSKIFKELDKSLHDRVSFDCGEAELNDFIQTQAAKHMQAGISRTMVLPAAMPLPNQKYPICSFYTIAPSSICRDTLPQ
AIGKKLPRYPIPVFLLAQLAVHKEFHGSGLGKASLIKALEYLWEINAHMRAYAIVVDCLTDQAESFYAKYGFEVLCEING
RVRMFIPMKTVGQLFT
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6N3J9I8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6N3J9J2 |