Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 4171848..4172398 | Replicon | chromosome |
| Accession | NZ_CP104755 | ||
| Organism | Shewanella putrefaciens strain 4H | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | N5094_RS18440 | Protein ID | WP_011918510.1 |
| Coordinates | 4172099..4172398 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | N5094_RS18435 | Protein ID | WP_011918511.1 |
| Coordinates | 4171848..4172090 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5094_RS18410 (N5094_18410) | 4166958..4168157 | + | 1200 | WP_261762122.1 | beta-ketoacyl-[acyl-carrier-protein] synthase family protein | - |
| N5094_RS18415 (N5094_18415) | 4168162..4168695 | + | 534 | WP_025008034.1 | hotdog family protein | - |
| N5094_RS18420 (N5094_18420) | 4168808..4169533 | + | 726 | WP_248069540.1 | 3-ketoacyl-ACP reductase FabG2 | - |
| N5094_RS18425 (N5094_18425) | 4169534..4170793 | + | 1260 | WP_248069538.1 | beta-ketoacyl-ACP synthase | - |
| N5094_RS18430 (N5094_18430) | 4170825..4171568 | + | 744 | WP_248069536.1 | hypothetical protein | - |
| N5094_RS18435 (N5094_18435) | 4171848..4172090 | + | 243 | WP_011918511.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N5094_RS18440 (N5094_18440) | 4172099..4172398 | + | 300 | WP_011918510.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5094_RS18445 (N5094_18445) | 4172928..4173641 | - | 714 | WP_014609649.1 | hypothetical protein | - |
| N5094_RS18450 (N5094_18450) | 4174001..4174477 | + | 477 | WP_261762123.1 | GNAT family N-acetyltransferase | - |
| N5094_RS18455 (N5094_18455) | 4174529..4175716 | - | 1188 | WP_115016493.1 | benzoate/H(+) symporter BenE family transporter | - |
| N5094_RS18460 (N5094_18460) | 4175880..4176446 | + | 567 | WP_014609647.1 | XRE family transcriptional regulator | - |
| N5094_RS18465 (N5094_18465) | 4176583..4177179 | - | 597 | WP_011787674.1 | FMN-dependent NADH-azoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11598.24 Da Isoelectric Point: 8.8270
>T259109 WP_011918510.1 NZ_CP104755:4172099-4172398 [Shewanella putrefaciens]
MNNKRYKLSRLSQTHLQQIKDYTLQHFSESQWHKYKESLISGLQMLADNPGLGRSCEDIYPNGFYFPIAKHTAYFTKEDD
FILIVALLGQPQLPQNHLK
MNNKRYKLSRLSQTHLQQIKDYTLQHFSESQWHKYKESLISGLQMLADNPGLGRSCEDIYPNGFYFPIAKHTAYFTKEDD
FILIVALLGQPQLPQNHLK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|