Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ygfYX/Cpta(toxin) |
Location | 3288243..3288912 | Replicon | chromosome |
Accession | NZ_CP104755 | ||
Organism | Shewanella putrefaciens strain 4H |
Toxin (Protein)
Gene name | ygfX | Uniprot ID | - |
Locus tag | N5094_RS14500 | Protein ID | WP_261761863.1 |
Coordinates | 3288243..3288683 (-) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | ygfY | Uniprot ID | - |
Locus tag | N5094_RS14505 | Protein ID | WP_014610118.1 |
Coordinates | 3288664..3288912 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5094_RS14475 (N5094_14475) | 3283749..3284222 | - | 474 | WP_261761862.1 | SoxR reducing system RseC family protein | - |
N5094_RS14480 (N5094_14480) | 3284233..3285165 | - | 933 | WP_011790278.1 | MucB/RseB C-terminal domain-containing protein | - |
N5094_RS14485 (N5094_14485) | 3285178..3285798 | - | 621 | WP_011790279.1 | anti sigma-E factor RseA C-terminal domain-containing protein | - |
N5094_RS14490 (N5094_14490) | 3285825..3286403 | - | 579 | WP_011790280.1 | RNA polymerase sigma factor RpoE | - |
N5094_RS14495 (N5094_14495) | 3286593..3288206 | + | 1614 | WP_248065600.1 | L-aspartate oxidase | - |
N5094_RS14500 (N5094_14500) | 3288243..3288683 | - | 441 | WP_261761863.1 | hypothetical protein | Toxin |
N5094_RS14505 (N5094_14505) | 3288664..3288912 | - | 249 | WP_014610118.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
N5094_RS14510 (N5094_14510) | 3288998..3289906 | - | 909 | WP_011790284.1 | transcriptional activator NhaR | - |
N5094_RS14515 (N5094_14515) | 3290014..3290400 | - | 387 | WP_011790285.1 | hypothetical protein | - |
N5094_RS14520 (N5094_14520) | 3290403..3291572 | - | 1170 | WP_011790286.1 | Na+/H+ antiporter NhaA | - |
N5094_RS14525 (N5094_14525) | 3291689..3292483 | - | 795 | WP_011790287.1 | thymidylate synthase | - |
N5094_RS14530 (N5094_14530) | 3292483..3293289 | - | 807 | WP_115015839.1 | prolipoprotein diacylglyceryl transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 17341.58 Da Isoelectric Point: 9.2750
>T259108 WP_261761863.1 NZ_CP104755:c3288683-3288243 [Shewanella putrefaciens]
VEEQHHSFSVKASFDQRLSLVVFMCVCSSSFLIWPYTEHWLVALLRLGLFLLSVSFLIWQLWRLKDWRLSFMLNGKGDGR
LSTGEHFRILRRTWVTPFVCMIYIDVEEKTRLVLLWADMFTGVDYRHLCRLLLKAKMLQAKSQVEI
VEEQHHSFSVKASFDQRLSLVVFMCVCSSSFLIWPYTEHWLVALLRLGLFLLSVSFLIWQLWRLKDWRLSFMLNGKGDGR
LSTGEHFRILRRTWVTPFVCMIYIDVEEKTRLVLLWADMFTGVDYRHLCRLLLKAKMLQAKSQVEI
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|